bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
positive regulation of MAPK cascade
(GO:0043410)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
SPAG9 2 -0.110 0.210 1.305
INSR 2 -0.850 0.830 1.143 0.785
PELI2 1 -0.150 0.600
IGF1R 1 -0.490 0.750 1.476 0.714
LAMTOR1 1 0.700 -0.850 0.343 0.382
ILK 1 -1.560 3.680 -0.463 -0.527
PDGFA 1 0.190 -0.340 -2.109 1.885
FLT4 0 0.940 -0.560
FGFR3 0 -1.120 1.390
CDC42 0 -0.170 0.490 -0.597 -1.527 -1.013
CDC42 0 1.240 -0.940 -0.597 -1.527 -1.013
FGFR1 0 0.210 0.150
FLT1 0 -1.240 1.900
GAB1 0 1.950 -1.110
SORBS3 0
SORBS3 0
KDR 0 0.860 -0.680
TRAF7 0 -1.410 2.040
BNIP2 0 -0.790 0.810
KSR1 0 0.100 0.600
ITGB1 0 0.390 -0.650 0.101 -0.036
RYK 0 0.020 0.190
CTNNB1 0 0.490 -0.230
CTNNB1 0 0.490 -0.230 -0.415 0.628 0.215
CDH2 0 -0.110 -0.060 -1.092 -0.918
HRAS 0 1.470 -0.520
F2R 0 0.220 0.110
SOX2 0 -0.250 0.870

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
BNIP2 Phosphorylation S114 1.031 0.808 _KGS(ph)ITEYTAAEEK_
CDC42 Ubiquitylation K173 -1.839 _DDPSTIEK(gl)LAK_
CDC42 Ubiquitylation K178 -0.801 -0.716 _NK(gl)QKPITPETAEK_
CDC42 Ubiquitylation K180 -1.806 _QK(gl)PITPETAEK(gl)LAR_
CDC42 Ubiquitylation K189 -1.082 _QKPITPETAEK(gl)LAR_
CDC42 Ubiquitylation K198 0.550 1.159 _AVK(gl)YVECSALTQK_
CDC42 Ubiquitylation K208 -0.937 0.038 _YVECSALTQK(gl)GLK_
CDC42 Ubiquitylation K228 -2.488 _NVFDEAILAALEPPEPK(gl)K_
CDC42 Ubiquitylation K229 -1.254 _NVFDEAILAALEPPEPKK(gl)_
CTNNB1 Ubiquitylation K158 -1.265 _AIPELTK(gl)LLNDEDQVVVNK_
CTNNB1 Ubiquitylation K180 -0.546 -0.636 _AAVM(ox)VHQLSK(gl)K_
CTNNB1 Ubiquitylation K181 -0.717 -0.729 _AAVMVHQLSKK(gl)_
CTNNB1 Phosphorylation S191 -0.024 0.129 _S(ph)PQMVSAIVR_
CTNNB1 Ubiquitylation K435 -0.350 _NK(gl)MM(ox)VCQVGGIEALVR_
CTNNB1 Ubiquitylation K496 -1.262 _LHYGLPVVVK(gl)_
CTNNB1 Phosphorylation S552 1.233 1.224 _RTS(ph)MGGTQQQFVEGVR_
CTNNB1 Phosphorylation T556 1.275 0.995 _RTSM(ox)GGT(ph)QQQFVEGVR_
CTNNB1 Ubiquitylation K671 -0.941 -0.934 _MSEDKPQDYK(gl)K_
F2R Ubiquitylation K421 0.836 0.568 _MDTCSSNLNNSIYK(gl)K_
FGFR1 Ubiquitylation K510 1.047 -0.221 _VTK(gl)VAVK_
FGFR3 Ubiquitylation K205 -0.115 _IGGIK(gl)LR_
FLT1 Ubiquitylation K953 -1.081 _MEPGLEQGK(gl)KPR_
FLT4 Ubiquitylation K987 -0.270 _FSK(gl)TEGGAR_
FLT4 Ubiquitylation K1064 -1.119 _DIYK(gl)DPDYVR_
GAB1 Phosphorylation S266 0.756 0.551 _SYS(ph)HDVLPK_
GAB1 Phosphorylation S367 0.230 0.176 _TAS(ph)DTDSSYCIPTAGMS(ph)PSR_
GAB1 Phosphorylation T369 -0.352 _TASDT(ph)DSSYCIPTAGMS(ph)PSR_
GAB1 Phosphorylation S381 -0.481 0.139 _TASDTDSSYCIPTAGM(ox)S(ph)PSR_
GAB1 Phosphorylation S401 0.266 0.788 _DAS(ph)SQDCYDIPR_
GAB1 Phosphorylation S402 0.328 0.633 _DASS(ph)QDCYDIPR_
GAB1 Phosphorylation S419 0.540 _SSS(ph)LEGFHNHFK_
HRAS Ubiquitylation K170 -1.005 _K(gl)LNPPDESGPGCMSCK_
IGF1R Ubiquitylation K47 1.146 _NDYQQLK(gl)R_
IGF1R Ubiquitylation K1033 5.779 _VAIK(gl)TVNEAASMR_
IGF1R Ubiquitylation K1168 0.191 _K(gl)GGKGLLPVR_
IGF1R Ubiquitylation K1171 0.232 _GGK(gl)GLLPVR_
ILK Ubiquitylation K85 -0.777 _DIVQK(gl)LLQYK_
ILK Ubiquitylation K426 -0.300 _LMK(gl)ICMNEDPAK_
ILK Ubiquitylation K435 -2.732 _ICMNEDPAK(gl)RPK_
INSR Ubiquitylation K1022 -0.603 _EK(gl)ITLLR_
INSR Ubiquitylation K1047 0.305 0.711 _DIIK(gl)GEAETR_
INSR Ubiquitylation K1057 0.482 0.484 _VAVK(gl)TVNESASLR_
INSR Ubiquitylation K1352 1.606 2.754 _DGGSSLGFK(gl)R_
ITGB1 Ubiquitylation K774 0.402 _MNAK(gl)WDTGENPIYK_
ITGB1 Ubiquitylation K784 -0.172 0.350 _WDTGENPIYK(gl)SAVTTVVNPK_
ITGB1 Ubiquitylation K794 0.755 0.604 _SAVTTVVNPK(gl)YEGK_
KDR Ubiquitylation K1064 -1.119 _DIYK(gl)DPDYVR_
KSR1 Phosphorylation S334 0.052 _FDLSHGS(ph)PQMVR_
KSR1 Phosphorylation S406 -0.052 -0.067 _RTES(ph)VPSDINNPVDR_
KSR1 Phosphorylation S569 -0.413 -0.383 _ADVLEAHEAEAEEPEAGKS(ph)EAEDDEDEVDDLPSSR_
LAMTOR1 Ubiquitylation K20 -0.365 -0.474 _K(gl)LLLDPSSPPTK_
LAMTOR1 Phosphorylation S27 -0.440 -0.557 _KLLLDPSS(ph)PPTK_
LAMTOR1 Ubiquitylation K31 -1.467 _KLLLDPSSPPTK(gl)ALNGAEPNYHSLPSAR_
PELI2 Ubiquitylation K172 1.788 0.291 _NIFLGEKAAK(gl)_
RYK Ubiquitylation K302 0.463 _IEK(gl)NDLR_
SORBS3 Phosphorylation S6 0.282 -0.078 _(ac)ADGGS(ph)PFLGRR_
SORBS3 Phosphorylation S109 -1.018 _LKFDFQAQS(ph)PK_
SORBS3 Phosphorylation T243 -0.650 -0.441 _LCDDGPQLPT(ph)SPR_
SORBS3 Phosphorylation S244 -0.506 -0.252 _LCDDGPQLPTS(ph)PR_
SORBS3 Phosphorylation S258 -0.155 0.017 _HPS(ph)SPSALR_
SORBS3 Phosphorylation S259 -0.175 -0.164 _HPSS(ph)PSALR_
SOX2 Phosphorylation S251 0.157 -0.109 _SEASSS(ph)PPVVTSSSHSR_
SPAG9 Ubiquitylation K178 0.616 _TK(gl)LHQLSGSDQLESTAHSR_
SPAG9 Phosphorylation S183 -0.041 0.617 _LHQLS(ph)GSDQLESTAHSR_
SPAG9 Phosphorylation S185 -0.229 0.589 _LHQLSGS(ph)DQLESTAHSR_
SPAG9 Phosphorylation S203 -0.173 0.319 _ERPIS(ph)LGIFPLPAGDGLLT(ph)PDAQK_
SPAG9 Phosphorylation T217 1.022 0.515 _ERPIS(ph)LGIFPLPAGDGLLT(ph)PDAQK_
SPAG9 Phosphorylation T226 2.211 2.141 _GGET(ph)PGSEQWK_
SPAG9 Phosphorylation T275 2.752 _AT(ph)TPASTANSDVATIPTDTPLKEENEGFVK_
SPAG9 Phosphorylation T276 2.516 2.823 _ATT(ph)PASTANSDVATIPTDTPLKEENEGFVK_
SPAG9 Phosphorylation T292 2.076 1.667 _ATTPASTANSDVATIPTDT(ph)PLKEENEGFVK_
SPAG9 Phosphorylation T330 0.261 _NVST(ph)GSAENEEKSEVQAIIESTPELDMDKDLSGYK_
SPAG9 Phosphorylation S339 -0.150 0.210 _NVSTGSAENEEKS(ph)EVQAIIESTPELDMDKDLSGYK_
SPAG9 Phosphorylation S593 0.642 _KRS(ph)STLSQLPGDK_
SPAG9 Phosphorylation S594 0.719 0.528 _RSS(ph)TLSQLPGDK_
SPAG9 Phosphorylation T595 0.585 _KRSST(ph)LSQLPGDK_
SPAG9 Ubiquitylation K653 -0.358 _VQAFGWSLPQK(gl)YK_
SPAG9 Ubiquitylation K699 -0.277 _LWCAVGVNLSGGK(gl)TR_
SPAG9 Phosphorylation S728 0.903 -0.047 _S(ph)ASQSSLDKLDQELKEQQK_
SPAG9 Phosphorylation S730 0.163 0.677 _SAS(ph)QSSLDKLDQELK_
SPAG9 Phosphorylation S732 0.961 0.900 _SASQS(ph)SLDKLDQELKEQQK_
SPAG9 Phosphorylation S733 0.740 0.712 _SASQSS(ph)LDKLDQELK_
SPAG9 Phosphorylation S813 0.253 _ETDYPAGEDLS(ph)ESGQVDK_
SPAG9 Phosphorylation S815 -0.037 _ETDYPAGEDLSES(ph)GQVDK_
SPAG9 Phosphorylation T1264 -1.557 -1.235 _AGPSAQEPGSQT(ph)PLK_
TRAF7 Phosphorylation S108 -0.756 -0.573 _STFS(ph)LPEEEEEPEPLVFAEQPSVK_
TRAF7 Ubiquitylation K160 -0.315 _SEK(gl)CPVDNVK_
TRAF7 Ubiquitylation K199 -1.430 -1.568 _VAGSGK(gl)PPIFEVDPR_


© Copyright Svejstrup Laboratory 2015