bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: SPAG9

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
SPAG9 2 7.470 -0.110 0.210 1.305

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
SPAG9 Phosphorylation T276 2.516 2.823 _ATT(ph)PASTANSDVATIPTDTPLKEENEGFVK_
SPAG9 Phosphorylation T275 2.752 _AT(ph)TPASTANSDVATIPTDTPLKEENEGFVK_
SPAG9 Phosphorylation T226 2.211 2.141 _GGET(ph)PGSEQWK_
SPAG9 Phosphorylation T292 2.076 1.667 _ATTPASTANSDVATIPTDT(ph)PLKEENEGFVK_
SPAG9 Phosphorylation S732 0.961 0.900 _SASQS(ph)SLDKLDQELKEQQK_
SPAG9 Phosphorylation S733 0.740 0.712 _SASQSS(ph)LDKLDQELK_
SPAG9 Phosphorylation S730 0.163 0.677 _SAS(ph)QSSLDKLDQELK_
SPAG9 Phosphorylation S593 0.642 _KRS(ph)STLSQLPGDK_
SPAG9 Phosphorylation S183 -0.041 0.617 _LHQLS(ph)GSDQLESTAHSR_
SPAG9 Phosphorylation S185 -0.229 0.589 _LHQLSGS(ph)DQLESTAHSR_
SPAG9 Phosphorylation T595 0.585 _KRSST(ph)LSQLPGDK_
SPAG9 Phosphorylation S594 0.719 0.528 _RSS(ph)TLSQLPGDK_
SPAG9 Phosphorylation T217 1.022 0.515 _ERPIS(ph)LGIFPLPAGDGLLT(ph)PDAQK_
SPAG9 Phosphorylation S203 -0.173 0.319 _ERPIS(ph)LGIFPLPAGDGLLT(ph)PDAQK_
SPAG9 Phosphorylation T330 0.261 _NVST(ph)GSAENEEKSEVQAIIESTPELDMDKDLSGYK_
SPAG9 Phosphorylation S813 0.253 _ETDYPAGEDLS(ph)ESGQVDK_
SPAG9 Phosphorylation S339 -0.150 0.210 _NVSTGSAENEEKS(ph)EVQAIIESTPELDMDKDLSGYK_
SPAG9 Phosphorylation S815 -0.037 _ETDYPAGEDLSES(ph)GQVDK_
SPAG9 Phosphorylation S728 0.903 -0.047 _S(ph)ASQSSLDKLDQELKEQQK_
SPAG9 Phosphorylation T1264 -1.557 -1.235 _AGPSAQEPGSQT(ph)PLK_
SPAG9 Ubiquitylation K178 0.616 _TK(gl)LHQLSGSDQLESTAHSR_
SPAG9 Ubiquitylation K653 -0.358 _VQAFGWSLPQK(gl)YK_
SPAG9 Ubiquitylation K699 -0.277 _LWCAVGVNLSGGK(gl)TR_

Background Information for SPAG9:


Pubmed-SPAG9 »
Uniprot-SPAG9 »
Biogrid-SPAG9 »
ProteomicsDB-SPAG9 »

Tumorportal-SPAG9 »
COSMIC-SPAG9 »
GenomeRNAi-SPAG9 »
Genecards-SPAG9


Protein-protein Interactions for SPAG9
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait ACOT12 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait ARFGAP1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait BIRC7 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait C15orf17 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait C16orf45 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait C3orf43 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait CACNG5 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait COMTD1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait FAM174A Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait KBTBD5 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait KIF16B Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait MAPK8IP3 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait MED9 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait MND1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait MREG Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait PLK1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait PODXL Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait RCCD1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait RRM2 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait RRM2B Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait SCARB2 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait SLC30A4 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait SPN Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait SYP Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait TMEM44 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait TPM1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait TPM3 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait VASN Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait ZBED1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait ZFPL1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in SPAG9
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members WD40_repeat_dom IPR017986 1.39
Category members JNK/Rab-associated_protein-1_N IPR019143 0


Protein complexes (CORUM database) featuring SPAG9
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members Corum 5230 CHUK-NFKB2-REL-IKBKG-SPAG9-NFKB1-NFKBIE-COPB2-TNIP1-NFKBIA-RELA-TNIP2 complex Database 0


Categories featuring SPAG9
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005515 protein binding Database INF
Category members GO Category GO:0005829 cytosol Database INF
Category members GO Category GO:0005737 cytoplasm Database 12.81
Category members GO Category GO:0016021 integral to membrane Database 7.67
Category members GO Category GO:0051146 striated muscle cell differentiation Database 1.01
Category members Pathway Pathway_295 PID_ARF6_TRAFFICKING_PATHWAY 0 0.9
Category members GO Category GO:0048471 perinuclear region of cytoplasm Database 0.39
Category members GO Category GO:0042147 retrograde transport, endosome to Golgi Database 0.26
Category members GO Category GO:0042692 muscle cell differentiation Database 0.1
Category members GO Category GO:0007257 activation of JUN kinase activity Database 0.08
Category members GO Category GO:0043410 positive regulation of MAPK cascade Database 0.06
Category members GO Category GO:0051149 positive regulation of muscle cell differentiation Database 0.04
Category members GO Category GO:0019894 kinesin binding Database 0.02
Category members GO Category GO:0000187 activation of MAPK activity Database 0
Category members GO Category GO:0001669 acrosomal vesicle Database 0
Category members GO Category GO:0007283 spermatogenesis Database 0
Category members GO Category GO:0008432 JUN kinase binding Database 0
Category members GO Category GO:0030335 positive regulation of cell migration Database 0
Category members GO Category GO:0045666 positive regulation of neuron differentiation Database 0
Category members GO Category GO:0048273 mitogen-activated protein kinase p38 binding Database 0
Category members GO Category GO:0051260 protein homooligomerization Database 0


.

© Copyright Svejstrup Laboratory 2015