bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
striated muscle cell differentiation
(GO:0051146)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
SPAG9 2 -0.110 0.210 1.305
MAPK14 2 -0.160 -0.350
KRAS 1 -0.510 0.620 1.031 0.887
KRAS 1 -0.510 0.620 0.246 -0.346
NRAS 1 1.810 -0.720 0.246 -0.346
MTPN 0 -1.050 2.170
RB1 0 1.180 -1.070 0.429 0.755
RB1 0 1.180 -1.070
BNIP2 0 -0.790 0.810
AKT1 0 -0.050 0.700
AKT1 0 0.860 -0.040
CDH2 0 -0.110 -0.060 -1.092 -0.918
HRAS 0 1.470 -0.520
CHUK 0 -0.480

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
AKT1 Phosphorylation S124 0.252 0.311 _SGS(ph)PSDNSGAEEMEVSLAKPK_
AKT1 Phosphorylation S126 -0.241 _SGSPS(ph)DNSGAEEM(ox)EVSLAK_
AKT1 Ubiquitylation K301 0.988 _EGIK(gl)DGATMK_
BNIP2 Phosphorylation S114 1.031 0.808 _KGS(ph)ITEYTAAEEK_
CHUK Ubiquitylation K296 -1.637 _GGPVDLTLK(gl)QPR_
HRAS Ubiquitylation K170 -1.005 _K(gl)LNPPDESGPGCMSCK_
KRAS Ubiquitylation K128 1.528 1.433 _TVDTK(gl)QAHELAK_
KRAS Ubiquitylation K235 0.591 0.087 _TVDTK(gl)QAQDLAR_
KRAS Ubiquitylation K254 -0.450 -0.156 _SYGIPFIETSAK(gl)TR_
MAPK14 Phosphorylation S2 3.221 3.623 _(ac)S(ph)QERPTFYR_
MAPK14 Phosphorylation T180 0.958 1.087 _HTDDEM(ox)T(ph)GYVATR_
MAPK14 Phosphorylation Y182 1.388 1.374 _HTDDEM(ox)TGY(ph)VATR_
MAPK14 Ubiquitylation K249 0.073 -1.380 _LVGTPGAELLKK(gl)_
MTPN Ubiquitylation K4 0.021 _(ac)CDK(gl)EFMWALK_
MTPN Phosphorylation T31 0.488 _GEDVNRT(ph)LEGGR_
MTPN Ubiquitylation K90 0.537 -0.107 _LLLSK(gl)GADK_
MTPN Ubiquitylation K97 -0.211 _TVK(gl)GPDGLTAFEATDNQAIK_
NRAS Ubiquitylation K128 1.528 1.433 _TVDTK(gl)QAHELAK_
RB1 Phosphorylation S69 -3.602 -3.397 _TAATAAAAAAEPPAPPPPPPPEEDPEQDS(ph)GPEDLPLVR_
RB1 Ubiquitylation K97 -0.546 _LK(gl)IPDHVR_
RB1 Phosphorylation T388 0.005 0.116 _TLQTDSIDSFETQRT(ph)PR_
RB1 Phosphorylation T405 -0.851 -0.901 _KSNLDEEVNVIPPHT(ph)PVR_
RB1 Phosphorylation S820 -0.019 _S(ph)PYKFPSSPLR_
RB1 Ubiquitylation K823 -2.214 _SPYK(gl)FPSSPLR_
RB1 Phosphorylation S827 0.824 0.111 _FPSS(ph)PLR_
RB1 Phosphorylation S839 -0.701 -1.045 _IPGGNIYIS(ph)PLKS(ph)PYK_
RB1 Ubiquitylation K842 -0.751 _IPGGNIYISPLK(gl)SPYK_
RB1 Phosphorylation S843 -0.701 -0.022 _IPGGNIYIS(ph)PLKS(ph)PYK_
RB1 Ubiquitylation K846 -2.084 _SPYK(gl)ISEGLPTPTK_
RB1 Phosphorylation T853 0.039 -0.555 _ISEGLPT(ph)PTKM(ox)T(ph)PR_
RB1 Ubiquitylation K856 -1.350 _ISEGLPTPTK(gl)MTPR_
RB1 Phosphorylation T858 -0.782 0.564 _ISEGLPT(ph)PTKMT(ph)PR_
RB1 Ubiquitylation K879 -0.187 _FQK(gl)INQMVCNSDR_
SPAG9 Ubiquitylation K178 0.616 _TK(gl)LHQLSGSDQLESTAHSR_
SPAG9 Phosphorylation S183 -0.041 0.617 _LHQLS(ph)GSDQLESTAHSR_
SPAG9 Phosphorylation S185 -0.229 0.589 _LHQLSGS(ph)DQLESTAHSR_
SPAG9 Phosphorylation S203 -0.173 0.319 _ERPIS(ph)LGIFPLPAGDGLLT(ph)PDAQK_
SPAG9 Phosphorylation T217 1.022 0.515 _ERPIS(ph)LGIFPLPAGDGLLT(ph)PDAQK_
SPAG9 Phosphorylation T226 2.211 2.141 _GGET(ph)PGSEQWK_
SPAG9 Phosphorylation T275 2.752 _AT(ph)TPASTANSDVATIPTDTPLKEENEGFVK_
SPAG9 Phosphorylation T276 2.516 2.823 _ATT(ph)PASTANSDVATIPTDTPLKEENEGFVK_
SPAG9 Phosphorylation T292 2.076 1.667 _ATTPASTANSDVATIPTDT(ph)PLKEENEGFVK_
SPAG9 Phosphorylation T330 0.261 _NVST(ph)GSAENEEKSEVQAIIESTPELDMDKDLSGYK_
SPAG9 Phosphorylation S339 -0.150 0.210 _NVSTGSAENEEKS(ph)EVQAIIESTPELDMDKDLSGYK_
SPAG9 Phosphorylation S593 0.642 _KRS(ph)STLSQLPGDK_
SPAG9 Phosphorylation S594 0.719 0.528 _RSS(ph)TLSQLPGDK_
SPAG9 Phosphorylation T595 0.585 _KRSST(ph)LSQLPGDK_
SPAG9 Ubiquitylation K653 -0.358 _VQAFGWSLPQK(gl)YK_
SPAG9 Ubiquitylation K699 -0.277 _LWCAVGVNLSGGK(gl)TR_
SPAG9 Phosphorylation S728 0.903 -0.047 _S(ph)ASQSSLDKLDQELKEQQK_
SPAG9 Phosphorylation S730 0.163 0.677 _SAS(ph)QSSLDKLDQELK_
SPAG9 Phosphorylation S732 0.961 0.900 _SASQS(ph)SLDKLDQELKEQQK_
SPAG9 Phosphorylation S733 0.740 0.712 _SASQSS(ph)LDKLDQELK_
SPAG9 Phosphorylation S813 0.253 _ETDYPAGEDLS(ph)ESGQVDK_
SPAG9 Phosphorylation S815 -0.037 _ETDYPAGEDLSES(ph)GQVDK_
SPAG9 Phosphorylation T1264 -1.557 -1.235 _AGPSAQEPGSQT(ph)PLK_


© Copyright Svejstrup Laboratory 2015