bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Category

Results for the Category
negative regulation of epithelial cell proliferation
(GO:0050680)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

 Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
DLG1 1 0.400 -0.220 1.552 0.102 0.488
TSC2 1 0.810 -0.710
TSC2 1 0.810 -0.710 -0.715
CDC73 1 1.000 -0.660 1.109 0.620 1.610 -0.862 0.436
MCC 1 -1.350 2.680
RUNX3 0 -0.550 0.450
CDH1 0 0.150 0.280 -0.623
FGFR3 0 -1.120 1.390
MEF2A 0 0.820 -0.530
MEF2A 0 0.820 -0.530
LRP6 0 0.210 0.050
MEF2C 0 -0.980 1.550
MEF2C 0 -0.980 1.550
TGFB1 0 -0.550 1.050
CDK6 0 -0.190 0.160
CDK6 0 -0.190 0.160 -0.510 0.013
WNT5A 0
RB1 0 1.180 -1.070 0.429 0.755
RB1 0 1.180 -1.070
SAV1 0 1.110 -0.700
SOX2 0 -0.250 0.870
PTCH1 0 0.630 -0.690

PTM Sites:

 Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
CDC73 Ubiquitylation K136 0.034 _AADEVLAEAK(gl)KPR_
CDC73 Ubiquitylation K161 1.275 _LEGHK(gl)EGIVQTEQIR_
CDC73 Ubiquitylation K198 0.681 _STIK(gl)TDLDDDITALK_
CDC73 Ubiquitylation K209 -0.003 -1.671 _TDLDDDITALK(gl)QR_
CDC73 Ubiquitylation K243 0.937 _TTILQSTGK(gl)NFSK_
CDC73 Ubiquitylation K247 0.739 _TTILQSTGKNFSK(gl)_
CDC73 Ubiquitylation K283 -0.189 _TK(gl)QPIPAAYNR_
CDK6 Ubiquitylation K3 0.121 0.039 _(ac)MEK(gl)DGLCR_
CDK6 Phosphorylation S236 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK6 Phosphorylation S249 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK6 Phosphorylation S385 0.649 _HSSIS(ph)PVRLPLNSSLGAELSR_
CDK6 Phosphorylation S420 0.004 -0.202 _ES(ph)KGSPVFLPR_
CDK6 Phosphorylation S423 -0.155 -0.297 _GS(ph)PVFLPR_
CDK6 Phosphorylation T514 0.364 0.570 _DSKPIALKEEIVT(ph)PK_
CDK6 Phosphorylation S681 -2.532 -2.051 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK6 Phosphorylation S685 -2.729 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK6 Phosphorylation T692 -0.765 -1.849 _AIT(ph)PPQQPYK_
CDK6 Phosphorylation S1082 -1.661 -0.980 _KETTSGTSTEPVKNS(ph)SPAPPQPAPGK_
CDK6 Phosphorylation S1083 -1.093 -1.330 _NSS(ph)PAPPQPAPGK_
CDK6 Phosphorylation T1244 -0.956 _RT(ph)PTMPQEEAAACPPHILPPEK_
DLG1 Phosphorylation S102 -1.455 _SKPSEPIQPVNTWEISSLPSSTVTSETLPSSLS(ph)PSVEK_
DLG1 Phosphorylation T115 -0.707 -1.378 _YQDEDT(ph)PPQEHISPQITNEVIGPELVHVSEK_
DLG1 Phosphorylation S122 -1.073 _YQDEDTPPQEHIS(ph)PQITNEVIGPELVHVSEK_
DLG1 Phosphorylation S158 0.773 _NLSEIENVHGFVSHSHIS(ph)PIK_
DLG1 Ubiquitylation K321 1.264 1.435 _IMEIK(gl)LIK_
DLG1 Ubiquitylation K361 0.180 _IIEGGAAHK(gl)DGK_
DLG1 Ubiquitylation K452 -0.704 _YSPVSK(gl)AVLGDDEITREPR_
DLG1 Ubiquitylation K556 0.105 _FEAK(gl)IHDLR_
DLG1 Phosphorylation S573 0.697 _EQM(ox)M(ox)NSSISSGS(ph)GSLR_
DLG1 Phosphorylation S575 0.255 0.729 _EQMMNSSISSGSGS(ph)LR_
DLG1 Ubiquitylation K843 1.259 _SMENIMEMNK(gl)R_
FGFR3 Ubiquitylation K205 -0.115 _IGGIK(gl)LR_
LRP6 Ubiquitylation K1443 -0.221 _GK(gl)SMISSLSIMGGSSGPPYDR_
MCC Phosphorylation S293 -1.041 _LQSVQATGPS(ph)SPGR_
MCC Phosphorylation S294 -1.402 -0.640 _LQSVQATGPSS(ph)PGR_
MCC Phosphorylation S405 -5.038 -4.462 _IREFEVETERLNS(ph)R_
MEF2A Ubiquitylation K23 -0.140 _QVTFTK(gl)R_
MEF2A Phosphorylation S235 0.664 -0.092 _AS(ph)PNLIGATGANSLGK_
MEF2A Phosphorylation T253 -1.271 _VMPT(ph)KSPPPPGGGNLGMNSR_
MEF2A Phosphorylation S255 -1.235 _VMPTKS(ph)PPPPGGGNLGMNSR_
MEF2A Phosphorylation S408 -0.173 -0.049 _SEPIS(ph)PPRDR_
MEF2A Phosphorylation S494 -0.858 -1.232 _GDFHSPIVLGRPPNTEDRES(ph)PSVK_
MEF2C Ubiquitylation K23 -0.140 _QVTFTK(gl)R_
MEF2C Phosphorylation S240 0.008 0.302 _NS(ph)PGLLVSPGNLNK_
MEF2C Phosphorylation S406 0.272 0.338 _SEPVS(ph)PPRDR_
PTCH1 Ubiquitylation K904 -0.390 _DKPIDISQLTK(gl)QR_
RB1 Phosphorylation S69 -3.602 -3.397 _TAATAAAAAAEPPAPPPPPPPEEDPEQDS(ph)GPEDLPLVR_
RB1 Ubiquitylation K97 -0.546 _LK(gl)IPDHVR_
RB1 Phosphorylation T388 0.005 0.116 _TLQTDSIDSFETQRT(ph)PR_
RB1 Phosphorylation T405 -0.851 -0.901 _KSNLDEEVNVIPPHT(ph)PVR_
RB1 Phosphorylation S820 -0.019 _S(ph)PYKFPSSPLR_
RB1 Ubiquitylation K823 -2.214 _SPYK(gl)FPSSPLR_
RB1 Phosphorylation S827 0.824 0.111 _FPSS(ph)PLR_
RB1 Phosphorylation S839 -0.701 -1.045 _IPGGNIYIS(ph)PLKS(ph)PYK_
RB1 Ubiquitylation K842 -0.751 _IPGGNIYISPLK(gl)SPYK_
RB1 Phosphorylation S843 -0.701 -0.022 _IPGGNIYIS(ph)PLKS(ph)PYK_
RB1 Ubiquitylation K846 -2.084 _SPYK(gl)ISEGLPTPTK_
RB1 Phosphorylation T853 0.039 -0.555 _ISEGLPT(ph)PTKM(ox)T(ph)PR_
RB1 Ubiquitylation K856 -1.350 _ISEGLPTPTK(gl)MTPR_
RB1 Phosphorylation T858 -0.782 0.564 _ISEGLPT(ph)PTKMT(ph)PR_
RB1 Ubiquitylation K879 -0.187 _FQK(gl)INQMVCNSDR_
RUNX3 Ubiquitylation K244 0.258 _NASAVMK(gl)NQVAR_
SAV1 Phosphorylation S27 1.144 _KETS(ph)PLLR_
SOX2 Phosphorylation S251 0.157 -0.109 _SEASSS(ph)PPVVTSSSHSR_
TGFB1 Ubiquitylation K50 -0.557 _GQILSK(gl)LR_
TSC2 Ubiquitylation K3 -1.397 _(ac)AK(gl)PTSKDSGLK_
TSC2 Ubiquitylation K14 -1.297 _DSGLKEK(gl)FK_
TSC2 Ubiquitylation K69 0.051 _MIGQICEVAK(gl)TK_
TSC2 Ubiquitylation K71 -0.157 _MIGQICEVAKTK(gl)_
TSC2 Ubiquitylation K258 -0.278 _ELCEPCWK(gl)LMR_
TSC2 Ubiquitylation K634 1.610 _LGLPNK(gl)DGVVR_
TSC2 Phosphorylation S950 -0.152 -0.529 _STS(ph)LNERPK_
TSC2 Phosphorylation S1064 -0.927 _SLLGLDSGELQSGPESSSS(ph)PGVHVR_
TSC2 Phosphorylation S1248 -0.604 _SNTDSAVVMEEGS(ph)PGEVPVLVEPPGLEDVEAALGMDRR_
TSC2 Phosphorylation S1329 -0.120 _S(ph)SSSPELQTLQDILGDPGDK_
TSC2 Phosphorylation S1331 -0.262 _SSS(ph)SPELQTLQDILGDPGDKADVGR_
TSC2 Phosphorylation S1332 -0.063 _SSSS(ph)PELQTLQDILGDPGDK_
TSC2 Phosphorylation S1355 0.174 0.351 _ADVGRLS(ph)PEVK_
TSC2 Phosphorylation S1362 0.859 _S(ph)QSGTLDGESAAWSASGEDSR_
TSC2 Phosphorylation S1364 0.522 0.550 _SQS(ph)GTLDGESAAWSASGEDSR_
TSC2 Phosphorylation T1366 0.137 _SQSGT(ph)LDGESAAWSASGEDSR_
TSC2 Phosphorylation S1396 0.498 _S(ph)PSGLRPR_
TSC2 Phosphorylation S1743 0.596 _RLISS(ph)VEDFTEFV_
WNT5A Ubiquitylation K268 -0.304 _VGDALK(gl)EK_


.

© Copyright Svejstrup Laboratory 2015