bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Category

Results for the Category
Rho GTPase binding
(GO:0017048)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

 Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
YBX2 2 0.320 -0.460 0.674 0.402 -1.244 -0.405
VCL 1 0.570 -0.620 2.233 0.870
PFN1 1 -0.430 -0.180 0.002 2.497 -0.084 0.348 -0.059
ARHGEF2 1 -0.650 0.360 -0.121 -0.287 0.319 0.984 0.013
CIT 1 -1.740 3.570 -1.113 0.349
AKAP13 1 -0.260 0.000
INF2 1 -0.800 1.620
INF2 1 1.730 -1.180
ROCK1 0 -1.420 2.380 -0.112 -0.732
DOCK9 0 1.110 -0.740
DAAM1 0 1.000 -0.650
ECT2 0 0.620 -0.960 -0.787
RTKN 0 1.030 -0.280
ARHGEF16 0 1.070 -1.120
DIAPH1 0 0.480 -0.910 -0.053 -0.130 0.367
ROCK2 0 -1.660 2.330
DIAPH3 0 0.980 -0.460
IQGAP1 0 -0.420 0.300 0.641 -0.402
IQGAP1 0 -0.420 0.300 1.363 0.406 0.007
DOCK11 0 -0.840 1.200 0.433 0.251 0.311
FMNL2 0 1.540 -0.760 0.647 0.873
FMNL3 0 -0.950 1.140 0.647 0.873
IQGAP3 0 1.720 -1.070 0.165 0.274
LRRK2 0 0.530 -0.620 -0.240
CDC42BPB 0 -1.290 1.790 0.546 0.645 0.683

PTM Sites:

 Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
AKAP13 Phosphorylation S1407 0.033 _ENWCTIEPCPDAASLLAS(ph)KQSPECENFLDVGLGR_
AKAP13 Phosphorylation S1645 0.260 0.639 _VDS(ph)LVSLSEEDLESDQR_
AKAP13 Phosphorylation S1650 1.957 1.098 _VDSLVSLS(ph)EEDLESDQR_
AKAP13 Phosphorylation S1879 -0.267 -0.048 _S(ph)AVLLVDETATTPIFANR_
AKAP13 Phosphorylation S1932 0.162 0.318 _FLSHS(ph)TDSLNK_
AKAP13 Phosphorylation S2401 -0.038 _DMAECSTPLPEDCS(ph)PTHSPR_
AKAP13 Phosphorylation S2564 0.644 0.859 _S(ph)LSRPSSLIEQEK_
AKAP13 Phosphorylation S2566 0.600 0.289 _SLS(ph)RPSSLIEQEK_
AKAP13 Phosphorylation S2712 -1.063 _IPSFFPSPEEPPS(ph)PSAPSIAK_
AKAP13 Phosphorylation S2721 1.298 1.110 _S(ph)GSLDSELSVSPK_
AKAP13 Phosphorylation S2731 -0.105 0.196 _SGSLDSELSVS(ph)PK_
ARHGEF16 Phosphorylation S6 1.170 _(ac)AQRHS(ph)DSSLEEK_
ARHGEF16 Phosphorylation S107 -0.357 0.678 _HQS(ph)FGAAVLSR_
ARHGEF16 Phosphorylation S230 0.538 0.191 _GLNTSQES(ph)DDDILDESSSPEGTQK_
ARHGEF2 Phosphorylation S196 -0.074 0.190 _SVS(ph)TTNIAGHFNDESPLGLR_
ARHGEF2 Phosphorylation S208 -1.192 _SVSTTNIAGHFNDES(ph)PLGLR_
ARHGEF2 Phosphorylation S217 0.850 _ILS(ph)QSTDSLNMR_
ARHGEF2 Phosphorylation S219 0.334 0.620 _ILSQS(ph)TDSLNMR_
ARHGEF2 Ubiquitylation K397 -0.617 _LYK(gl)ELYAR_
ARHGEF2 Phosphorylation S689 2.510 1.206 _SES(ph)LESPR_
ARHGEF2 Phosphorylation S735 -0.212 _EPALPLEPDS(ph)GGNTSPGVTANGEAR_
ARHGEF2 Phosphorylation T739 -0.489 _EPALPLEPDSGGNT(ph)SPGVTANGEAR_
ARHGEF2 Phosphorylation S740 -0.461 -0.375 _EPALPLEPDSGGNTS(ph)PGVTANGEAR_
ARHGEF2 Phosphorylation S930 -0.782 -1.060 _S(ph)LPAGDALYLSFNPPQPSR_
ARHGEF2 Phosphorylation S976 0.649 0.809 _QELGS(ph)PEER_
CDC42BPB Ubiquitylation K338 -0.347 _LGQNGIEDFKK(gl)_
CDC42BPB Ubiquitylation K426 0.566 _SIMQSNTLTK(gl)DEDVQR_
CDC42BPB Phosphorylation S481 0.701 0.480 _ALSNS(ph)NRDKEIK_
CDC42BPB Ubiquitylation K1337 1.400 1.105 _GCQLMATATLK(gl)R_
CDC42BPB Phosphorylation S1690 -1.711 -2.133 _HSTPSNSSNPSGPPS(ph)PNSPHR_
CIT Phosphorylation S440 0.108 -0.025 _SESVVSGLDS(ph)PAK_
CIT Phosphorylation S1940 -2.591 _VASS(ph)PAPPEGPSHPR_
CIT Phosphorylation S1971 0.032 _DKS(ph)PGRPLER_
DAAM1 Ubiquitylation K781 0.856 _LQSLYFKK(gl)_
DIAPH1 Phosphorylation S22 0.053 0.108 _S(ph)PDELPSAGGDGGK_
DIAPH1 Ubiquitylation K503 0.696 0.481 _HELQVEMK(gl)K_
DIAPH1 Ubiquitylation K504 0.243 0.685 _HELQVEM(ox)KK(gl)_
DIAPH3 Ubiquitylation K275 -0.804 _SLSLLAK(gl)AVDPR_
DOCK11 Phosphorylation S12 0.246 _RLS(ph)KPGTAAELR_
DOCK11 Phosphorylation S437 0.259 _EMLWGSSTQLAS(ph)DGSPK_
DOCK11 Ubiquitylation K498 0.817 _VLQGNITHCAEPYIK(gl)NSDPVK_
DOCK11 Phosphorylation S1237 0.049 0.017 _EDS(ph)RGSLIPEGATGFPDQGNTGENTR_
DOCK11 Phosphorylation S1240 0.135 _EDSRGS(ph)LIPEGATGFPDQGNTGENTR_
DOCK9 Phosphorylation S21 -0.346 -0.108 _ALS(ph)KPGTAAELR_
FMNL2 Phosphorylation S171 0.529 0.626 _S(ph)IEDLHR_
FMNL2 Phosphorylation S1016 -0.450 0.078 _LLEQEALMEQQDPKS(ph)PSHK_
FMNL2 Phosphorylation S1018 0.250 0.320 _LLEQEALMEQQDPKSPS(ph)HK_
FMNL3 Phosphorylation S171 0.529 0.626 _S(ph)IEDLHR_
FMNL3 Phosphorylation S1016 -0.450 0.078 _LLEQEALMEQQDPKS(ph)PSHK_
FMNL3 Phosphorylation S1018 0.250 0.320 _LLEQEALMEQQDPKSPS(ph)HK_
INF2 Ubiquitylation K571 -0.122 1.307 _LNWQK(gl)LPSNVAR_
INF2 Phosphorylation S588 -0.743 0.276 _EHNSMWASLS(ph)SPDAEAVEPDFSSIER_
INF2 Phosphorylation S589 0.279 _EHNSMWASLSS(ph)PDAEAVEPDFSSIER_
INF2 Ubiquitylation K612 -1.329 -0.213 _LFSFPAAK(gl)PK_
INF2 Ubiquitylation K614 -0.266 _LFSFPAAK(gl)PK_
INF2 Ubiquitylation K637 0.191 1.601 _EITFLDAKK(gl)_
INF2 Phosphorylation S1083 -1.063 _RSSWYVDAS(ph)DVLTTEDPQCPQPLEGAWPVTLGDAQALKPLK_
INF2 Phosphorylation S1147 0.167 -0.076 _DPTSLLGVLQAEADS(ph)TSEGLEDAVHSR_
IQGAP1 Ubiquitylation K953 0.650 _NKEQLSDMMMINK(gl)QK_
IQGAP1 Ubiquitylation K959 0.713 0.074 _GGLK(gl)ALSK_
IQGAP1 Ubiquitylation K1389 0.638 1.119 _TILLNTK(gl)R_
IQGAP1 Ubiquitylation K1442 0.488 _SK(gl)SVKEDSNLTLQEK_
IQGAP1 Phosphorylation S1443 0.392 0.273 _SKS(ph)VKEDSNLTLQEK_
IQGAP1 Ubiquitylation K1445 0.863 _SVK(gl)EDSNLTLQEK_
IQGAP3 Ubiquitylation K661 0.344 _ALESAMAKK(gl)_
IQGAP3 Phosphorylation T1426 -0.517 _SLT(ph)AHSLLPLAEK_
PFN1 Ubiquitylation K54 -0.190 0.319 _TFVNITPAEVGVLVGK(gl)DR_
PFN1 Ubiquitylation K70 0.186 0.451 _SSFYVNGLTLGGQK(gl)CSVIR_
PFN1 Ubiquitylation K91 -0.513 -0.205 _TK(gl)STGGAPTFNVTVTK_
PFN1 Ubiquitylation K105 0.309 -0.352 _STGGAPTFNVTVTK(gl)TDK_
PFN1 Ubiquitylation K108 0.414 -0.098 _TDK(gl)TLVLLMGK_
PFN1 Ubiquitylation K126 0.640 0.539 _EGVHGGLINK(gl)K_
PFN1 Ubiquitylation K127 0.582 0.353 _EGVHGGLINKK(gl)_
ROCK1 Phosphorylation S1105 -0.245 -0.845 _LLDLSDSTSVAS(ph)FPSADETDGNLPESR_
ROCK2 Ubiquitylation K1222 -0.679 _ADAK(gl)EIPR_
RTKN Ubiquitylation K100 -2.570 _EAQVLGK(gl)TSR_
RTKN Phosphorylation S220 0.314 _LSSS(ph)LGR_
RTKN Phosphorylation S242 -1.726 _ASLDSAGGSGSS(ph)PILLPTPVVGGPR_
RTKN Phosphorylation S520 -1.032 -1.196 _TFS(ph)LDAVPPDHSPR_
VCL Ubiquitylation K219 -0.376 0.161 _NSK(gl)NQGIEEALK_
VCL Ubiquitylation K228 0.195 _NQGIEEALK(gl)NR_
VCL Phosphorylation S288 0.364 _DPS(ph)ASPGDAGEQAIR_
VCL Phosphorylation S290 -0.415 _DPSAS(ph)PGDAGEQAIR_
VCL Ubiquitylation K476 0.572 0.356 _QVATALQNLQTK(gl)TNR_
VCL Ubiquitylation K639 0.665 0.718 _AANFENHSGK(gl)LGATAEK_
VCL Ubiquitylation K666 0.502 _STVEGIQASVK(gl)TAR_
VCL Ubiquitylation K768 0.256 _ILLVAK(gl)R_
VCL Ubiquitylation K784 -0.707 _EAVK(gl)AASDELSK_
VCL Ubiquitylation K792 -0.889 -1.201 _AASDELSK(gl)TISPMVMDAK_
VCL Ubiquitylation K815 -0.780 _AVAGNISDPGLQK(gl)SFLDSGYR_
VCL Ubiquitylation K1020 0.159 0.667 _ALIQCAK(gl)DIAK_
VCL Ubiquitylation K1070 0.504 0.692 _ILSTVK(gl)ATMLGR_
YBX2 Phosphorylation S34 -1.234 -1.488 _S(ph)PVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAAASLATAAGSEDAEK_
YBX2 Phosphorylation S79 -2.262 _SPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAAASLATAAGS(ph)EDAEKK_
YBX2 Ubiquitylation K90 3.724 2.851 _VLATK(gl)VLGTVK_
YBX2 Ubiquitylation K96 5.830 4.056 _VLGTVK(gl)WFNVR_
YBX2 Ubiquitylation K113 1.472 1.136 _NDTK(gl)EDVFVHQTAIK_
YBX2 Ubiquitylation K124 -0.184 0.337 _NDTKEDVFVHQTAIK(gl)K(gl)NNPR_
YBX2 Ubiquitylation K125 -0.123 0.220 _NDTKEDVFVHQTAIK(gl)K(gl)NNPR_
YBX2 Phosphorylation S203 -0.609 -0.604 _NYAGEEEEEGSGS(ph)SEGFDPPATDR_
YBX2 Ubiquitylation K268 -0.103 -0.702 _IQAGEIGEMK(gl)DGVPEGAQLQGPVHR_
YBX2 Phosphorylation S324 -1.327 -0.720 _PAPAVGEAEDKENQQATSGPNQPS(ph)VR_


.

© Copyright Svejstrup Laboratory 2015