bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: INF2

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
INF2 1 2.238 -0.800 1.620
INF2 1 2.238 1.730 -1.180

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
INF2 Ubiquitylation K637 0.191 1.601 _EITFLDAKK(gl)_
INF2 Ubiquitylation K571 -0.122 1.307 _LNWQK(gl)LPSNVAR_
INF2 Phosphorylation S589 0.279 _EHNSMWASLSS(ph)PDAEAVEPDFSSIER_
INF2 Phosphorylation S588 -0.743 0.276 _EHNSMWASLS(ph)SPDAEAVEPDFSSIER_
INF2 Phosphorylation S1147 0.167 -0.076 _DPTSLLGVLQAEADS(ph)TSEGLEDAVHSR_
INF2 Ubiquitylation K612 -1.329 -0.213 _LFSFPAAK(gl)PK_
INF2 Ubiquitylation K614 -0.266 _LFSFPAAK(gl)PK_
INF2 Phosphorylation S1083 -1.063 _RSSWYVDAS(ph)DVLTTEDPQCPQPLEGAWPVTLGDAQALKPLK_

Background Information for INF2:


Pubmed-INF2 »
Uniprot-INF2 »
Biogrid-INF2 »
ProteomicsDB-INF2 »

Tumorportal-INF2 »
COSMIC-INF2 »
GenomeRNAi-INF2 »
Genecards-INF2


Protein-protein Interactions for INF2
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait ACTB Cat. description Hein, Mann, Cell 2015
Category members IP bait ACTR2 Cat. description Hein, Mann, Cell 2015
Category members IP bait ADD1 Cat. description Hein, Mann, Cell 2015
Category members IP bait ANLN Cat. description Hein, Mann, Cell 2015
Category members IP bait ARRB2 Cat. description Hein, Mann, Cell 2015
Category members IP bait CALML3 Cat. description Hein, Mann, Cell 2015
Category members IP bait CAPZA2 Cat. description Hein, Mann, Cell 2015
Category members IP bait CORO1C Cat. description Hein, Mann, Cell 2015
Category members IP bait CRK Cat. description Hein, Mann, Cell 2015
Category members IP bait DBN1 Cat. description Hein, Mann, Cell 2015
Category members IP bait FLNA Cat. description Hein, Mann, Cell 2015
Category members IP bait FLNB Cat. description Hein, Mann, Cell 2015
Category members IP bait FLOT1 Cat. description Hein, Mann, Cell 2015
Category members IP bait FLOT2 Cat. description Hein, Mann, Cell 2015
Category members IP bait GAK Cat. description Hein, Mann, Cell 2015
Category members IP bait IQGAP1 Cat. description Hein, Mann, Cell 2015
Category members IP bait KIAA1430 Cat. description Hein, Mann, Cell 2015
Category members IP bait LIMA1 Cat. description Hein, Mann, Cell 2015
Category members IP bait MAPRE1 Cat. description Hein, Mann, Cell 2015
Category members IP bait MYH10 Cat. description Hein, Mann, Cell 2015
Category members IP bait MYH11 Cat. description Hein, Mann, Cell 2015
Category members IP bait MYH9 Cat. description Hein, Mann, Cell 2015
Category members IP bait MYO18A Cat. description Hein, Mann, Cell 2015
Category members IP bait MYO19 Cat. description Hein, Mann, Cell 2015
Category members IP bait MYO1C Cat. description Hein, Mann, Cell 2015
Category members IP bait MYO5C Cat. description Hein, Mann, Cell 2015
Category members IP bait PPP1CB Cat. description Hein, Mann, Cell 2015
Category members IP bait PPP1CC Cat. description Hein, Mann, Cell 2015
Category members IP bait SEPT9 Cat. description Hein, Mann, Cell 2015
Category members IP bait SYNPO Cat. description Hein, Mann, Cell 2015
Category members IP bait TMOD3 Cat. description Hein, Mann, Cell 2015
Category members IP bait TPM1 Cat. description Hein, Mann, Cell 2015
Category members IP bait USO1 Cat. description Hein, Mann, Cell 2015
Category members IP bait PFN2 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait RSPRY1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait TMOD3 Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in INF2
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members ARM-type_fold IPR016024 9.26
Category members WH2_dom IPR003124 0.04
Category members FH3_dom IPR010472 0.03
Category members GTPase-bd IPR010473 0.03
Category members FH2_Formin IPR015425 0


Protein complexes (CORUM database) featuring INF2
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring INF2
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005634 nucleus Database INF
Category members GO Category GO:0005737 cytoplasm Database 12.81
Category members GO Category GO:0005488 binding Database 9.32
Category members GO Category GO:0003779 actin binding Database 5.41
Category members GO Category GO:0030036 actin cytoskeleton organization Database 1.08
Category members GO Category GO:0017048 Rho GTPase binding Database 0.69
Category members GO Category GO:0005783 endoplasmic reticulum Database 0.62
Category members GO Category GO:0048471 perinuclear region of cytoplasm Database 0.39
Category members GO Category GO:0016043 cellular component organization Database 0.03
Category members Disease phenotype Familial_idiopathic_steroid-resistant_nephrotic_syndrome_with_focal_segmental_hyalinosis Familial idiopathic steroid-resistant nephrotic syndrome with focal segmental hyalinosis Database 0
Category members GO Category GO:0032535 regulation of cellular component size Database 0


.

© Copyright Svejstrup Laboratory 2015