bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Category

Results for the Category
WH2_dom
(IPR003124)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

 Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
COBLL1 2 2.040 -0.900
INF2 1 -0.800 1.620
INF2 1 1.730 -1.180
COBL 0 -1.440 1.820
WASL 0 -0.430 0.380
WIPF3 0
WASF3 0 -0.950 1.600 0.137 -0.055
JMY 0 1.260 -0.540 0.925
WASF2 0 -0.540 0.560 0.137 -0.055
WIPF2 0 -0.750 0.760

PTM Sites:

 Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
COBL Phosphorylation S962 1.121 -0.189 _LS(ph)TQDRPAAIHR_
COBLL1 Phosphorylation S392 0.378 0.821 _SMS(ph)VDETDKSPCEAGR_
COBLL1 Phosphorylation S1016 1.889 _DMLPS(ph)PEQTLSPLSK_
INF2 Ubiquitylation K571 -0.122 1.307 _LNWQK(gl)LPSNVAR_
INF2 Phosphorylation S588 -0.743 0.276 _EHNSMWASLS(ph)SPDAEAVEPDFSSIER_
INF2 Phosphorylation S589 0.279 _EHNSMWASLSS(ph)PDAEAVEPDFSSIER_
INF2 Ubiquitylation K612 -1.329 -0.213 _LFSFPAAK(gl)PK_
INF2 Ubiquitylation K614 -0.266 _LFSFPAAK(gl)PK_
INF2 Ubiquitylation K637 0.191 1.601 _EITFLDAKK(gl)_
INF2 Phosphorylation S1083 -1.063 _RSSWYVDAS(ph)DVLTTEDPQCPQPLEGAWPVTLGDAQALKPLK_
INF2 Phosphorylation S1147 0.167 -0.076 _DPTSLLGVLQAEADS(ph)TSEGLEDAVHSR_
JMY Phosphorylation S115 0.344 _SSAWAEGGS(ph)PR_
JMY Phosphorylation S713 -0.151 -0.126 _GAAS(ph)PVLQEDHCDSLPSVLQVEEK_
JMY Phosphorylation S971 -0.306 _IKEAS(ph)PESEDEEEALPCTDWEN_
JMY Phosphorylation S974 -0.581 _IKEASPES(ph)EDEEEALPCTDWEN_
WASF2 Ubiquitylation K169 0.110 _MLQDTK(gl)DIMK_
WASF2 Ubiquitylation K216 1.027 _MGQEFVESK(gl)EK_
WASF2 Ubiquitylation K218 0.488 _MGQEFVESK(gl)EK_
WASF2 Phosphorylation S293 -1.620 _RSS(ph)VVSPSHPPPAPPLGSPPGPK_
WASF3 Ubiquitylation K169 0.110 _MLQDTK(gl)DIMK_
WASF3 Ubiquitylation K216 1.027 _MGQEFVESK(gl)EK_
WASF3 Ubiquitylation K218 0.488 _MGQEFVESK(gl)EK_
WASF3 Phosphorylation S293 -1.620 _RSS(ph)VVSPSHPPPAPPLGSPPGPK_
WASL Phosphorylation S430 0.399 0.664 _VEQNSRPVS(ph)CSGR_
WASL Phosphorylation S432 1.141 _VEQNSRPVSCS(ph)GR_
WIPF2 Phosphorylation S235 -1.359 _EGPPAPPPVKPPPS(ph)PVNIR_
WIPF3 Phosphorylation S149 -1.530 _TISGPLIPPAS(ph)PR_


.

© Copyright Svejstrup Laboratory 2015