bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
cytoplasmic microtubule
(GO:0005881)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
TUBA1B 1 0.217 0.208 1.746
TUBA1B 1 0.742 -0.126 0.853 0.585
REEP2 1 1.620 -1.070
REEP2 1 1.620 -1.070
BCL10 1 0.000 0.200
CLASP2 1 -1.110 -0.564
CLASP2 1 0.249 0.298
TUBA1C 1 0.217 0.208 1.746
TUBA1C 1 0.742 -0.126 0.853 0.585
TUBG2 0 -0.710 0.010 -0.141 -0.630 -0.211 -0.844 -0.821
CLASP1 0 -0.960 1.790 0.173 0.298
GTSE1 0 0.840 -0.390 1.016 0.270
TUBA3D 0 -0.410 1.730 0.742 -0.126 0.853 0.585
CYLD 0 -1.250 2.010
BIRC5 0 -0.309 -0.536
MAPRE1 0 1.670 -1.110 -0.525 -0.434 -0.532
MID1 0 0.310 -0.200 -0.219 0.525
APC 0 0.810 -0.720 0.008 0.065
APC2 0 0.850 -0.820 0.008 0.065
TMEM214 0 -0.760 1.340 0.637 0.440
TUBA4A 0 0.400 -0.430 -2.652
TUBGCP2 0 -0.250 0.100 -0.053 -0.306
CLIP1 0 1.350 -1.100
TUBG1 0 -0.710 1.260 -0.141 -0.630 -0.211 -0.844 -0.821
VIMP 0 0.490 -0.510 -2.036
CKAP2 0 -0.450 -0.407 -0.342
CKAP2 0
DYNC2LI1 0
ARL3 0 0.820 -0.590
RANBP10 0 0.990 -0.810
SS18 0 0.150 -0.700 -0.079 -1.091 0.600
KIF2B 0 -1.490 2.250 -1.129 -0.459 0.458 -0.570 -0.151
SRPRB 0 0.920 -0.400 -0.155 -0.328 0.005
BICD1 0 0.240 -0.570
TUBA3E 0 0.320 0.680 0.742 -0.126 0.853 0.585
TUBA1A 0 0.200 -0.030 0.742 -0.126 0.853 0.585
HID1 0 0.790 -0.460
DCXR 0 1.860 -0.520 0.231 0.845 0.593
TUBA3C 0 0.420 -1.050 0.742 -0.126 0.853 0.585

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
APC Phosphorylation S746 0.284 0.140 _DANIMS(ph)PGSSLPSLHVR_
APC Phosphorylation S749 0.276 _YKDANIM(ox)SPGS(ph)SLPSLHVR_
APC Phosphorylation S782 -0.471 -0.446 _ALEAELDAQHLSETFDNIDNLS(ph)PK_
APC Phosphorylation S1044 0.097 0.452 _YSDEQLNSGRQS(ph)PSQNER_
APC Phosphorylation S1046 0.412 1.084 _YSDEQLNSGRQSPS(ph)QNER_
APC Phosphorylation S1362 -0.007 0.328 _AVEFSSGAKS(ph)PSK_
APC Phosphorylation T1440 -1.261 -0.875 _SKT(ph)PPPPPQTAQTK_
APC Phosphorylation T1775 0.099 _KPT(ph)SPVKPIPQNTEYR_
APC Phosphorylation S1776 0.019 0.099 _KPTS(ph)PVKPIPQNTEYR_
APC Phosphorylation S2095 0.363 _DIQRPDSEHGLS(ph)PDSENFDWK_
APC Phosphorylation S2127 -0.031 _AIQEGANSIVSSLHQAAAAACLS(ph)R_
APC Phosphorylation S2260 -0.624 _TPAS(ph)KSPSEGQTATTSPR_
APC Phosphorylation S2262 -0.026 0.240 _TPASKS(ph)PSEGQTATTSPR_
APC Phosphorylation S2451 -0.249 -0.285 _EAPS(ph)PTLR_
APC Phosphorylation S2537 -0.505 _SHSES(ph)PSRLPINR_
APC Phosphorylation S2571 0.693 0.817 _TGS(ph)SSSILSASSESSEK_
APC Phosphorylation S2673 0.326 0.501 _S(ph)GRSPTGNTPPVIDSVSEK_
APC Phosphorylation S2676 -0.478 0.096 _SGRS(ph)PTGNTPPVIDSVSEK_
APC Phosphorylation T2678 -0.028 0.136 _SPT(ph)GNTPPVIDSVSEK_
APC2 Phosphorylation S746 0.284 0.140 _DANIMS(ph)PGSSLPSLHVR_
APC2 Phosphorylation S749 0.276 _YKDANIM(ox)SPGS(ph)SLPSLHVR_
APC2 Phosphorylation S782 -0.471 -0.446 _ALEAELDAQHLSETFDNIDNLS(ph)PK_
APC2 Phosphorylation S1044 0.097 0.452 _YSDEQLNSGRQS(ph)PSQNER_
APC2 Phosphorylation S1046 0.412 1.084 _YSDEQLNSGRQSPS(ph)QNER_
APC2 Phosphorylation S1362 -0.007 0.328 _AVEFSSGAKS(ph)PSK_
APC2 Phosphorylation T1440 -1.261 -0.875 _SKT(ph)PPPPPQTAQTK_
APC2 Phosphorylation T1775 0.099 _KPT(ph)SPVKPIPQNTEYR_
APC2 Phosphorylation S1776 0.019 0.099 _KPTS(ph)PVKPIPQNTEYR_
APC2 Phosphorylation S2095 0.363 _DIQRPDSEHGLS(ph)PDSENFDWK_
APC2 Phosphorylation S2127 -0.031 _AIQEGANSIVSSLHQAAAAACLS(ph)R_
APC2 Phosphorylation S2260 -0.624 _TPAS(ph)KSPSEGQTATTSPR_
APC2 Phosphorylation S2262 -0.026 0.240 _TPASKS(ph)PSEGQTATTSPR_
APC2 Phosphorylation S2451 -0.249 -0.285 _EAPS(ph)PTLR_
APC2 Phosphorylation S2537 -0.505 _SHSES(ph)PSRLPINR_
APC2 Phosphorylation S2571 0.693 0.817 _TGS(ph)SSSILSASSESSEK_
APC2 Phosphorylation S2673 0.326 0.501 _S(ph)GRSPTGNTPPVIDSVSEK_
APC2 Phosphorylation S2676 -0.478 0.096 _SGRS(ph)PTGNTPPVIDSVSEK_
APC2 Phosphorylation T2678 -0.028 0.136 _SPT(ph)GNTPPVIDSVSEK_
ARL3 Ubiquitylation K9 0.216 _K(gl)LKSAPDQEVR_
ARL3 Ubiquitylation K11 -0.579 _LK(gl)SAPDQEVR_
BCL10 Phosphorylation S138 1.515 1.393 _SNS(ph)DESNFSEK_
BICD1 Phosphorylation S546 -0.356 _S(ph)GSLKGPDDPR_
BICD1 Phosphorylation S548 -0.359 0.539 _SGS(ph)LKGPDDPR_
BICD1 Phosphorylation S860 0.095 0.555 _QFS(ph)PSLCDQSR_
BIRC5 Ubiquitylation K15 -1.446 _(ac)GAPTLPPAWQPFLK(gl)DHR_
BIRC5 Ubiquitylation K113 0.088 -0.061 _HSSGCAFLSVK(gl)K_
BIRC5 Ubiquitylation K114 -0.061 _HSSGCAFLSVK(gl)K_
CKAP2 Ubiquitylation K70 -0.239 _VVTSEDQVQEGTK(gl)VLK_
CKAP2 Ubiquitylation K91 -0.704 _RPAESK(gl)NNTVVGK_
CKAP2 Ubiquitylation K187 0.203 _GQIVQSK(gl)INSFR_
CKAP2 Ubiquitylation K269 0.404 _DTVK(gl)QGISR_
CKAP2 Ubiquitylation K513 -0.260 _SQEK(gl)ANLGENMEK_
CKAP2 Phosphorylation T579 -0.511 -0.053 _TKDPTHDVKT(ph)PNTETR_
CLASP1 Phosphorylation S598 0.439 0.280 _S(ph)RSDIDVNAAASAK_
CLASP1 Phosphorylation S600 0.501 0.771 _SRS(ph)DIDVNAAASAK_
CLASP1 Phosphorylation S636 -0.434 _VSSSSGTTPFSSAAALPPGSYAS(ph)LGR_
CLASP1 Phosphorylation S646 0.212 0.217 _RQS(ph)SGSATNVASTPDNR_
CLASP1 Phosphorylation S797 0.478 0.348 _VLSTS(ph)TDLEAAVADALK_
CLASP1 Phosphorylation S1091 0.125 -0.316 _NSSNTSVGS(ph)PSNTIGR_
CLASP1 Phosphorylation S1196 0.643 0.634 _S(ph)QEDLNEPIKR_
CLASP2 Phosphorylation S241 0.318 0.351 _DKS(ph)FDDEESVDGNRPSSAASAFK_
CLASP2 Phosphorylation S560 0.651 0.296 _SSSSS(ph)QESLNRPFSSK_
CLASP2 Phosphorylation S593 -0.339 0.138 _ASS(ph)LPGSLQR_
CLASP2 Phosphorylation S601 1.688 _S(ph)RSDIDVNAAAGAK_
CLASP2 Phosphorylation S603 0.514 0.132 _SRS(ph)DIDVNAAAGAK_
CLASP2 Phosphorylation S758 -0.210 0.330 _IPRPSVS(ph)QGCSR_
CLASP2 Phosphorylation S762 0.315 0.366 _IPRPSVSQGCS(ph)R_
CLASP2 Phosphorylation T806 0.762 _VLNT(ph)GSDVEEAVADALK_
CLASP2 Phosphorylation S808 0.347 0.264 _VLNTGS(ph)DVEEAVADALK_
CLASP2 Phosphorylation S1264 0.155 _EAMFDDDADQFPDDLS(ph)LDHSDLVAELLK_
CLASP2 Phosphorylation S1268 0.155 _EAMFDDDADQFPDDLS(ph)LDHSDLVAELLK_
CLASP2 Ubiquitylation K1425 1.196 0.967 _MQTK(gl)VIER_
CLIP1 Phosphorylation T146 -1.263 _AT(ph)SPLCTSTASMVSSSPSTPSNIPQKPSQPAAK_
CLIP1 Phosphorylation S147 -1.094 _ATS(ph)PLCTSTASMVSSSPSTPSNIPQKPSQPAAK_
CLIP1 Phosphorylation S195 1.169 0.950 _TASES(ph)ISNLSEAGS(ph)IK_
CLIP1 Phosphorylation S204 0.319 0.405 _TASESISNLSEAGS(ph)IK_
CYLD Ubiquitylation K114 -1.068 0.927 _FSLFK(gl)NR_
DCXR Ubiquitylation K17 -0.045 _VLVTGAGK(gl)GIGR_
DCXR Ubiquitylation K171 -2.040 _VMALELGPHK(gl)IR_
DCXR Ubiquitylation K198 -1.245 _AK(gl)TMLNR_
DYNC2LI1 Ubiquitylation K151 -1.054 _TNAK(gl)AVSEMR_
GTSE1 Phosphorylation S168 -1.174 _LLASS(ph)PALPSSGAQAR_
GTSE1 Phosphorylation S243 -0.544 -0.645 _KEIPAS(ph)PSR_
GTSE1 Phosphorylation S477 -0.326 -0.430 _AQRPQS(ph)CTSVGR_
GTSE1 Phosphorylation T479 -0.221 _AQRPQSCT(ph)SVGR_
GTSE1 Phosphorylation S536 -1.250 -1.754 _AVGS(ph)PLCVPAR_
GTSE1 Phosphorylation S575 -0.557 -0.137 _LVDVS(ph)PDRGSPPSR_
GTSE1 Phosphorylation S580 -0.308 _LVDVS(ph)PDRGS(ph)PPSR_
GTSE1 Phosphorylation S592 0.112 0.100 _VPQALNFS(ph)PEESDSTFSK_
GTSE1 Phosphorylation S705 -0.288 -0.375 _NVAKPSPVVGQLIDLSSPLIQLS(ph)PEADKENVDSPLLK_
GTSE1 Phosphorylation S715 -0.326 _NVAKPSPVVGQLIDLSSPLIQLSPEADKENVDS(ph)PLLK_
HID1 Phosphorylation T591 0.003 -0.184 _T(ph)GSQEGTSMEGSRPAAPAEPGTLK_
HID1 Phosphorylation S593 -0.268 -0.156 _TGS(ph)QEGTSMEGSRPAAPAEPGTLK_
KIF2B Ubiquitylation K90 0.245 _DNLPLQENVTIQK(gl)QK_
KIF2B Ubiquitylation K92 0.245 _DNLPLQENVTIQK(gl)QK_
KIF2B Ubiquitylation K99 -0.690 _SVNSK(gl)IPAPK_
KIF2B Phosphorylation S187 -0.968 _GSSSANPVNS(ph)VR_
KIF2B Ubiquitylation K196 0.896 _SCLVK(gl)EVEK_
KIF2B Ubiquitylation K365 1.333 _THTMGGDLSGK(gl)AQNASK_
KIF2B Ubiquitylation K524 0.780 -0.116 _SLLALK(gl)ECIR_
KIF2B Ubiquitylation K702 1.411 _DVIK(gl)ALR_
MAPRE1 Ubiquitylation K83 0.426 _ILQAGFK(gl)R_
MAPRE1 Ubiquitylation K148 -1.162 _QGQETAVAPSLVAPALNK(gl)PK_
MAPRE1 Phosphorylation S155 -0.696 _KPLTS(ph)SSAAPQRPISTQR_
MAPRE1 Phosphorylation T166 -1.133 -0.732 _KPLTSSSAAPQRPIST(ph)QR_
MAPRE1 Ubiquitylation K220 0.230 0.891 _DFYFGK(gl)LR_
MID1 Ubiquitylation K74 0.275 0.651 _GLDGLK(gl)R_
MID1 Phosphorylation S96 -0.141 0.050 _ASVSGPNS(ph)PSETRR_
RANBP10 Phosphorylation S361 -0.043 _SQDS(ph)YPGSPSLSPR_
RANBP10 Phosphorylation S369 0.270 0.128 _SQDSYPGSPSLS(ph)PR_
REEP2 Ubiquitylation K101 -0.653 _FVHPTLSNKEK(gl)_
REEP2 Ubiquitylation K113 0.687 _DK(gl)SYETMMR_
REEP2 Ubiquitylation K145 -0.047 -0.750 _GVLSEK(gl)LR_
REEP2 Ubiquitylation K147 0.067 0.692 _GQGVLSEK(gl)LR_
REEP2 Phosphorylation S150 -0.933 -0.228 _S(ph)FSMQDLTLIRDEDALPLQRPDGR_
REEP2 Phosphorylation S152 -0.540 0.055 _SFS(ph)MQDLTLIR_
REEP2 Phosphorylation S177 -0.872 _LRPS(ph)PGSLLDTIEDLGDDPALSLR_
REEP2 Phosphorylation S180 -0.664 _LRPSPGS(ph)LLDTIEDLGDDPALSLR_
REEP2 Phosphorylation S210 3.474 _TEAS(ph)EDDMGDKAPK_
SRPRB Ubiquitylation K191 -0.160 0.940 _SAK(gl)LIQQQLEK_
SRPRB Phosphorylation T214 0.004 0.792 _SAAPST(ph)LDSSSTAPAQLGK_
SRPRB Ubiquitylation K227 0.280 _SAAPSTLDSSSTAPAQLGK(gl)K_
SRPRB Ubiquitylation K228 -1.460 0.280 _SAAPSTLDSSSTAPAQLGKK(gl)_
TMEM214 Ubiquitylation K69 0.147 _GFENIMK(gl)R_
TMEM214 Ubiquitylation K104 -0.118 _KVATPPNQNQK(gl)QGR_
TMEM214 Ubiquitylation K382 -1.607 _ATPSCPPEMK(gl)K_
TMEM214 Ubiquitylation K383 -1.530 _ATPSCPPEMKK(gl)_
TUBG1 Ubiquitylation K287 1.041 -0.053 _K(gl)TTVLDVMR_
TUBG1 Ubiquitylation K301 0.057 -0.550 _LLQPK(gl)NVMVSTGR_
TUBG2 Ubiquitylation K287 1.041 -0.053 _K(gl)TTVLDVMR_
TUBG2 Ubiquitylation K301 0.057 -0.550 _LLQPK(gl)NVMVSTGR_
TUBGCP2 Ubiquitylation K483 0.619 _ILSTGK(gl)YLNVVR_
TUBGCP2 Ubiquitylation K508 0.050 _EIIYTLK(gl)ER_
TUBGCP2 Ubiquitylation K626 -0.087 _VLAIETKQEK(gl)_
TUBGCP2 Ubiquitylation K907 -1.549 _SQK(gl)ATPQVPVLR_
VIMP Ubiquitylation K117 -2.952 -1.705 _AAAAVEPDVVVK(gl)R_
VIMP Ubiquitylation K190 -1.565 -1.157 _KPQEEDSPGPSTSSVLK(gl)R_


© Copyright Svejstrup Laboratory 2015