bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: CLIP1

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
CLIP1 0 2.119 1.350 -1.100

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
CLIP1 Phosphorylation S195 1.169 0.950 _TASES(ph)ISNLSEAGS(ph)IK_
CLIP1 Phosphorylation S204 0.319 0.405 _TASESISNLSEAGS(ph)IK_
CLIP1 Phosphorylation S147 -1.094 _ATS(ph)PLCTSTASMVSSSPSTPSNIPQKPSQPAAK_
CLIP1 Phosphorylation T146 -1.263 _AT(ph)SPLCTSTASMVSSSPSTPSNIPQKPSQPAAK_

Background Information for CLIP1:


Pubmed-CLIP1 »
Uniprot-CLIP1 »
Biogrid-CLIP1 »
ProteomicsDB-CLIP1 »

Tumorportal-CLIP1 »
COSMIC-CLIP1 »
GenomeRNAi-CLIP1 »
Genecards-CLIP1


Protein-protein Interactions for CLIP1
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait DYNC1H1 Cat. description Hein, Mann, Cell 2015
Category members IP bait MAPRE1 Cat. description Hein, Mann, Cell 2015
Category members IP bait SMURF2 Cat. description Hein, Mann, Cell 2015
Category members IP bait BMP1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait CADPS Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait DAB2IP Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait GORASP1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait RUNDC3A Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in CLIP1
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members Znf_CCHC IPR001878 1.51
Category members Tropomyosin IPR000533 0.08
Category members CAP-Gly_domain IPR000938 0.04
Category members Prefoldin IPR009053 0


Protein complexes (CORUM database) featuring CLIP1
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring CLIP1
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005515 protein binding Database INF
Category members GO Category GO:0005829 cytosol Database INF
Category members GO Category GO:0005737 cytoplasm Database 12.81
Category members Pathway Pathway_320 REACTOME_CELL_CYCLE 0 11.08
Category members GO Category GO:0000278 mitotic cell cycle Database 10.63
Category members Pathway Pathway_321 REACTOME_MITOTIC_M_M_G1_PHASES 0 5.47
Category members Pathway Pathway_323 REACTOME_DNA_REPLICATION 0 5.24
Category members Pathway Pathway_317 REACTOME_CELL_CYCLE_MITOTIC 0 4.82
Category members Pathway Pathway_726 REACTOME_MITOTIC_PROMETAPHASE 0 2.41
Category members GO Category GO:0000776 kinetochore Database 2.24
Category members GO Category GO:0007067 mitosis Database 2.23
Category members Pathway Pathway_724 PID_MTOR_4PATHWAY 0 2
Category members Pathway Pathway_729 PID_LIS1_PATHWAY 0 1.41
Category members GO Category GO:0015630 microtubule cytoskeleton Database 1.34
Category members GO Category GO:0005874 microtubule Database 1.21
Category members GO Category GO:0003676 nucleic acid binding Database 0.83
Category members GO Category GO:0015631 tubulin binding Database 0.83
Category members GO Category GO:0008017 microtubule binding Database 0.79
Category members GO Category GO:0005813 centrosome Database 0.75
Category members GO Category GO:0030659 cytoplasmic vesicle membrane Database 0.62
Category members GO Category GO:0001578 microtubule bundle formation Database 0.49
Category members GO Category GO:0051010 microtubule plus-end binding Database 0.47
Category members GO Category GO:0001726 ruffle Database 0.33
Category members GO Category GO:0005768 endosome Database 0.29
Category members GO Category GO:0008270 zinc ion binding Database 0.29
Category members GO Category GO:0044354 macropinosome Database 0.25
Category members GO Category GO:0005881 cytoplasmic microtubule Database 0.04
Category members GO Category GO:0005882 intermediate filament Database 0
Category members GO Category GO:0006810 transport Database 0
Category members GO Category GO:0031116 positive regulation of microtubule polymerization Database 0
Category members GO Category GO:0035371 microtubule plus-end Database 0
Category members GO Category GO:0042803 protein homodimerization activity Database 0
Category members GO Category GO:0046872 metal ion binding Database 0


.

© Copyright Svejstrup Laboratory 2015