bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
macropinosome
(GO:0044354)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
CLIP1 0 1.350 -1.100
ANXA2 0 -1.230 1.610
ANXA2 0 -0.830 1.020
ANXA2 0 -0.740 0.850
ANXA2 0 -1.230 1.610 -0.075 0.002 -0.652 0.608 0.330
ANXA2 0 -0.830 1.020 -0.075 0.002 -0.652 0.608 0.330
ANXA2 0 -0.740 0.850 -0.075 0.002 -0.652 0.608 0.330

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
ANXA2 Phosphorylation S12 0.179 _(ac)STVHEILCKLS(ph)LEGDHSTPPSAYGSVK_
ANXA2 Phosphorylation T19 0.015 -0.422 _LSLEGDHST(ph)PPSAYGSVK_
ANXA2 Phosphorylation S22 -0.273 -1.050 _LSLEGDHSTPPS(ph)AYGSVK_
ANXA2 Phosphorylation Y24 -1.100 _LSLEGDHSTPPSAY(ph)GSVK_
ANXA2 Phosphorylation S26 -0.518 -0.691 _LSLEGDHSTPPSAYGS(ph)VK_
ANXA2 Ubiquitylation K49 0.729 _TK(gl)GVDEVTIVNILTNR_
ANXA2 Ubiquitylation K148 0.314 1.024 _VYK(gl)EMYK_
ANXA2 Ubiquitylation K176 -0.855 0.760 _LMVALAK(gl)GR_
ANXA2 Ubiquitylation K204 0.375 1.026 _DLYDAGVK(gl)R_
ANXA2 Ubiquitylation K206 -0.599 _DLYDAGVK(gl)RK_
ANXA2 Ubiquitylation K302 0.390 _SEVDMLK(gl)IR_
ANXA2 Ubiquitylation K324 0.768 0.350 _SLYYYIQQDTK(gl)GDYQK_
CLIP1 Phosphorylation T146 -1.263 _AT(ph)SPLCTSTASMVSSSPSTPSNIPQKPSQPAAK_
CLIP1 Phosphorylation S147 -1.094 _ATS(ph)PLCTSTASMVSSSPSTPSNIPQKPSQPAAK_
CLIP1 Phosphorylation S195 1.169 0.950 _TASES(ph)ISNLSEAGS(ph)IK_
CLIP1 Phosphorylation S204 0.319 0.405 _TASESISNLSEAGS(ph)IK_


© Copyright Svejstrup Laboratory 2015