bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Category

Results for the Category
SH3/SH2 adaptor activity
(GO:0005070)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

 Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
KHDRBS1 1 -0.370 -0.090
KHDRBS1 1 -0.370 -0.090 -0.648 -1.258 -0.381 -0.646 -0.079
TP53BP2 1 1.060 -0.800 -0.399 -0.481
LASP1 0 0.860 0.020 -0.031 0.195
LASP1 0 0.860 0.020
SKAP2 0 -0.330 0.880
PAG1 0 -0.550 1.760
SORBS1 0 0.660 -0.330
CRKL 0 0.290 -0.620
GRB10 0 0.900 -0.860
GAB1 0 1.950 -1.110
IRS4 0 -0.240 -0.060 -0.868 -1.279 -1.308 -0.107 0.122
TOB1 0 1.290 -1.000
EPS8 0 -0.740 0.680
EPS8 0 -0.740 0.680 1.272
RUSC1 0 0.280 -0.220
CRK 0 -0.790 0.230
ARHGAP1 0 0.280 0.190
GRB2 0 -0.240 0.300 -1.021 0.057 0.906
PTPN11 0 -0.210 -0.400 0.644 1.053 0.451
SRC 0 0.050 0.470 -0.031
ITSN2 0 -0.710 0.950 0.287 0.672

PTM Sites:

 Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
ARHGAP1 Phosphorylation S50 1.380 1.255 _SS(ph)SPELVTHLK_
ARHGAP1 Phosphorylation S51 1.221 1.064 _SSS(ph)PELVTHLK_
CRK Phosphorylation S40 0.533 0.363 _DS(ph)STSPGDYVLSVSENSR_
CRK Phosphorylation S41 1.065 0.801 _DSS(ph)TSPGDYVLSVSENSR_
CRKL Phosphorylation S41 0.868 _DS(ph)STCPGDYVLSVSENSR_
CRKL Phosphorylation S107 -0.818 -1.177 _YPS(ph)PPMGSVSAPNLPTAEDNLEYVR_
EPS8 Phosphorylation S625 -2.045 _PADTPPAPS(ph)PPPTPAPVPVPLPPSTPAPVPVSK_
GAB1 Phosphorylation S266 0.756 0.551 _SYS(ph)HDVLPK_
GAB1 Phosphorylation S367 0.230 0.176 _TAS(ph)DTDSSYCIPTAGMS(ph)PSR_
GAB1 Phosphorylation T369 -0.352 _TASDT(ph)DSSYCIPTAGMS(ph)PSR_
GAB1 Phosphorylation S381 -0.481 0.139 _TASDTDSSYCIPTAGM(ox)S(ph)PSR_
GAB1 Phosphorylation S401 0.266 0.788 _DAS(ph)SQDCYDIPR_
GAB1 Phosphorylation S402 0.328 0.633 _DASS(ph)QDCYDIPR_
GAB1 Phosphorylation S419 0.540 _SSS(ph)LEGFHNHFK_
GRB10 Phosphorylation S104 -0.985 -0.688 _SIQPQVS(ph)PR_
GRB2 Ubiquitylation K10 0.146 _YDFK(gl)ATADDELSFK_
GRB2 Ubiquitylation K20 -0.078 _ATADDELSFK(gl)R_
GRB2 Ubiquitylation K69 -0.362 0.641 _AK(gl)AEEMLSK_
GRB2 Ubiquitylation K76 0.754 _AEEMLSK(gl)QR_
GRB2 Ubiquitylation K109 0.381 -0.002 _FGNDVQHFK(gl)VLR_
IRS4 Phosphorylation S64 -0.090 -0.062 _S(ph)DSESEEEDLPVGEEVCK_
IRS4 Phosphorylation S66 -0.354 -0.098 _SDS(ph)ESEEEDLPVGEEVCK_
IRS4 Ubiquitylation K99 -1.384 _YFVLK(gl)LETADAPAR_
IRS4 Ubiquitylation K202 -0.581 -0.941 _LILESK(gl)R_
IRS4 Ubiquitylation K240 -0.370 -0.760 _DVWQVIVK(gl)PR_
IRS4 Ubiquitylation K248 -0.351 -0.699 _K(gl)ELSGVFR_
IRS4 Phosphorylation S409 -0.928 -0.559 _FVTPSEPVAHS(ph)R_
IRS4 Phosphorylation S427 -0.406 0.053 _AVS(ph)VPASFFR_
IRS4 Phosphorylation S439 -1.003 -1.061 _RLAPS(ph)PARPR_
IRS4 Phosphorylation S457 0.337 _LS(ph)SEVSGSGSGNFGEEGNPQGK_
IRS4 Phosphorylation S458 0.236 _LSS(ph)EVSGSGSGNFGEEGNPQGK_
IRS4 Ubiquitylation K618 0.019 0.005 _SYFGK(gl)LTQSK_
IRS4 Ubiquitylation K674 -0.511 -0.585 _EVK(gl)DAEIPEGAAR_
IRS4 Phosphorylation Y743 -0.204 0.833 _GY(ph)MMMFPR_
IRS4 Phosphorylation S751 -1.810 -1.680 _VS(ph)PPPAPS(ph)PPK_
IRS4 Phosphorylation S757 -2.068 _VS(ph)PPPAPS(ph)PPK_
IRS4 Phosphorylation T764 -0.886 _APDT(ph)NKEDDSKDNDSESDYMFMAPGAGAIPK_
IRS4 Phosphorylation S775 -0.869 _APDTNKEDDSKDNDS(ph)ESDYMFMAPGAGAIPK_
IRS4 Phosphorylation S777 -0.884 -1.011 _APDTNKEDDSKDNDSES(ph)DYMFMAPGAGAIPK_
IRS4 Phosphorylation Y779 -0.702 -0.231 _APDTNKEDDSKDNDSESDY(ph)MFMAPGAGAIPK_
IRS4 Phosphorylation S804 -0.814 -0.440 _S(ph)WSSYFSLPNPFR_
IRS4 Phosphorylation S810 -1.350 _SWSSYFS(ph)LPNPFR_
IRS4 Phosphorylation S817 -1.106 -1.146 _S(ph)SPLGQNDNSEYVPM(ox)LPGK_
IRS4 Phosphorylation S818 -1.196 -1.146 _S(ph)SPLGQNDNSEYVPM(ox)LPGK_
IRS4 Phosphorylation S826 -0.663 -0.805 _SSPLGQNDNS(ph)EYVPM(ox)LPGK_
IRS4 Ubiquitylation K835 -1.658 -1.572 _SSPLGQNDNSEYVPM(ox)LPGK(gl)FLGR_
IRS4 Phosphorylation S872 -2.103 _PGDGGS(ph)PSKPSDHEPPK_
IRS4 Ubiquitylation K897 -0.308 -0.294 _LSFITK(gl)GYK_
IRS4 Phosphorylation Y921 0.195 -0.259 _EADSSSDY(ph)VNM(ox)DFTK_
IRS4 Ubiquitylation K928 -0.946 -1.115 _EADSSSDYVNMDFTK(gl)R_
IRS4 Phosphorylation S931 -0.413 -1.058 _RES(ph)NTPAPSTQGLPDSWGIIAEPR_
IRS4 Phosphorylation T933 -1.405 _RESNT(ph)PAPSTQGLPDSWGIIAEPR_
IRS4 Phosphorylation S1061 0.641 0.325 _IYVVDPFSECCM(ox)DISLS(ph)PSR_
IRS4 Phosphorylation S1091 -0.218 -0.449 _SQS(ph)FFAAAR_
IRS4 Phosphorylation S1107 -0.374 -0.244 _AAVSAFPTDS(ph)LER_
IRS4 Phosphorylation S1231 -1.675 _VPRPPEREDS(ph)DNDDDTHVR_
IRS4 Phosphorylation S1252 -0.763 _RDNQFDS(ph)PKR_
IRS4 Ubiquitylation K1254 -2.066 -1.156 _RDNQFDSPK(gl)R_
ITSN2 Ubiquitylation K583 0.151 _NMQFSNTPDSGVSLLHK(gl)K_
ITSN2 Ubiquitylation K584 -0.412 _NMQFSNTPDSGVSLLHKK(gl)_
ITSN2 Ubiquitylation K596 1.277 _LK(gl)EQLDALEK_
ITSN2 Phosphorylation S889 -0.357 -0.319 _TVSPGSVS(ph)PIHGQGQVVENLK_
KHDRBS1 Phosphorylation S18 0.745 -0.921 _S(ph)GSM(ox)DPSGAHPSVR_
KHDRBS1 Phosphorylation S20 0.944 -0.215 _SGS(ph)M(ox)DPSGAHPSVR_
KHDRBS1 Phosphorylation S58 9.021 _AS(ph)PATQPPPLLPPSATGPDATVGGPAPTPLLPPSATASVK_
KHDRBS1 Ubiquitylation K165 -0.612 0.332 _VLIPVK(gl)QYPK_
KHDRBS1 Ubiquitylation K169 -0.739 0.728 _QYPK(gl)FNFVGK_
KHDRBS1 Ubiquitylation K185 0.103 0.578 _ILGPQGNTIK(gl)R_
KHDRBS1 Ubiquitylation K194 0.511 _LQEETGAK(gl)ISVLGK_
KHDRBS1 Ubiquitylation K432 -1.686 _APPARPVK(gl)GAYR_
LASP1 Ubiquitylation K42 -0.445 _MTLNMK(gl)NYK_
LASP1 Ubiquitylation K75 0.405 _LK(gl)QQSELQSQVR_
LASP1 Phosphorylation T104 -1.734 _GFSVVADT(ph)PELQR_
LASP1 Phosphorylation S146 0.068 _MGPSGGEGMEPERRDS(ph)QDGSSYR_
PAG1 Phosphorylation S288 0.574 0.875 _EGGEAEESATDTTS(ph)ETNK_
PTPN11 Ubiquitylation K124 0.562 _EAEK(gl)LLTEK_
RUSC1 Ubiquitylation K511 -0.990 _NLVQK(gl)AQLGDSR_
RUSC1 Ubiquitylation K803 -1.519 _LFGVPGGPAENENGALK(gl)SR_
SKAP2 Ubiquitylation K125 0.222 _AGYLEK(gl)R_
SORBS1 Phosphorylation S57 -0.823 0.018 _ETPSSSPAS(ph)PQETR_
SORBS1 Phosphorylation S548 -0.502 -0.518 _RVGEQDSAPTQEKPTS(ph)PGK_
SRC Phosphorylation S17 -0.604 -0.689 _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_
SRC Phosphorylation S75 0.060 0.331 _LFGGFNSSDTVTS(ph)PQR_
TOB1 Phosphorylation T204 -0.200 0.244 _T(ph)SPINLGLNVNDLLK_
TOB1 Phosphorylation S205 -0.200 0.244 _T(ph)SPINLGLNVNDLLK_
TP53BP2 Ubiquitylation K102 0.149 _SQDPSLK(gl)R_
TP53BP2 Ubiquitylation K152 0.224 _QQQQIEAQQQLLATK(gl)EQR_
TP53BP2 Ubiquitylation K224 -0.390 _LVEEIEQMNNLFQQK(gl)QR_
TP53BP2 Ubiquitylation K234 -0.113 _ELVLAVSK(gl)VEELTR_
TP53BP2 Ubiquitylation K268 -0.429 _LYK(gl)ELQLR_
TP53BP2 Ubiquitylation K283 -0.866 _NKLNQEQNAK(gl)LQQQR_
TP53BP2 Ubiquitylation K303 -0.302 _NSEVAVMDK(gl)R_
TP53BP2 Ubiquitylation K322 -2.045 _AALQQK(gl)ENLPVSSDGNLPQQAASAPSR_
TP53BP2 Phosphorylation S480 0.458 0.944 _NQS(ph)SEDILR_
TP53BP2 Phosphorylation S556 1.443 1.433 _VLLS(ph)PSIPSVGQDQTLSPGSK_
TP53BP2 Phosphorylation S569 1.774 _VLLS(ph)PSIPSVGQDQTLS(ph)PGSK_
TP53BP2 Phosphorylation S698 -0.309 -0.362 _IPRPLS(ph)PTK_
TP53BP2 Phosphorylation T700 -0.449 -0.429 _IPRPLSPT(ph)K_
TP53BP2 Phosphorylation S737 -0.172 -0.748 _RSS(ph)ITEPEGPNGPNIQK_


.

© Copyright Svejstrup Laboratory 2015