bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
PID_IGF1_PATHWAY
(Pathway_603)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
YWHAE 1 0.440 -0.380 1.095 -0.160
YWHAE 1 0.440 -0.380 1.129 0.621 0.321
RAF1 1 2.020 -1.230
IGF1R 1 -0.490 0.750 1.476 0.714
GNB2L1 1 1.000 -0.100 0.279 1.704
GNB2L1 1 1.000 -0.100 -0.278 -0.107 -0.424
BAD 0 -0.660 1.190
PRKCZ 0 -0.290 0.310
NCK2 0 -0.870 1.530
PXN 0 1.020 -0.760
CRKL 0 0.290 -0.620
GRB10 0 0.900 -0.860
RPS6KB1 0 0.850 -0.600
SOS1 0 0.500 -0.620 -0.570
PIK3CA 0
PDPK1 0 0.050 -0.440
AKT1 0 -0.050 0.700
AKT1 0 0.860 -0.040
PIK3R1 0 1.910 -1.220 -0.441 0.147
PRKCD 0 0.250 0.070 0.578 0.427
YWHAZ 0 0.880 -0.450 0.433 1.494 -0.337 0.631 0.064
CRK 0 -0.790 0.230
IRS1 0
HRAS 0 1.470 -0.520
GRB2 0 -0.240 0.300 -1.021 0.057 0.906
PTPN11 0 -0.210 -0.400 0.644 1.053 0.451
PRKD1 0 1.050 0.130
PRKD1 0 1.050 0.130
PRKD1 0 1.050 0.130
IRS2 0 -0.190 -0.130
PTPN1 0 -0.150 0.310 1.066 0.459 0.251 0.322 0.379

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
AKT1 Phosphorylation S124 0.252 0.311 _SGS(ph)PSDNSGAEEMEVSLAKPK_
AKT1 Phosphorylation S126 -0.241 _SGSPS(ph)DNSGAEEM(ox)EVSLAK_
AKT1 Ubiquitylation K301 0.988 _EGIK(gl)DGATMK_
BAD Phosphorylation S74 -0.904 -0.452 _HS(ph)SYPAGTEDDEGM(ox)GEEPSPFR_
BAD Phosphorylation S75 -0.914 -0.660 _HSS(ph)YPAGTEDDEGMGEEPSPFR_
BAD Phosphorylation S97 0.056 _S(ph)RSAPPNLWAAQR_
BAD Phosphorylation S99 -0.299 0.161 _S(ph)APPNLWAAQR_
BAD Phosphorylation S118 1.277 1.089 _RM(ox)S(ph)DEFVDSFKK_
CRK Phosphorylation S40 0.533 0.363 _DS(ph)STSPGDYVLSVSENSR_
CRK Phosphorylation S41 1.065 0.801 _DSS(ph)TSPGDYVLSVSENSR_
CRKL Phosphorylation S41 0.868 _DS(ph)STCPGDYVLSVSENSR_
CRKL Phosphorylation S107 -0.818 -1.177 _YPS(ph)PPMGSVSAPNLPTAEDNLEYVR_
GNB2L1 Ubiquitylation K38 -0.238 0.350 _DK(gl)TIIMWK_
GNB2L1 Ubiquitylation K106 -0.290 _RFVGHTK(gl)DVLSVAFSSDNR_
GNB2L1 Ubiquitylation K130 0.632 _TIK(gl)LWNTLGVCK_
GNB2L1 Ubiquitylation K175 -0.554 -0.015 _LVK(gl)VWNLANCK_
GNB2L1 Ubiquitylation K183 -0.161 -0.282 _VWNLANCK(gl)_
GNB2L1 Ubiquitylation K185 -0.061 -0.249 _VWNLANCKLK(gl)_
GNB2L1 Ubiquitylation K257 -0.288 _YWLCAATGPSIK(gl)_
GNB2L1 Ubiquitylation K271 0.756 -0.007 _IIVDELK(gl)QEVISTSSK_
GRB10 Phosphorylation S104 -0.985 -0.688 _SIQPQVS(ph)PR_
GRB2 Ubiquitylation K10 0.146 _YDFK(gl)ATADDELSFK_
GRB2 Ubiquitylation K20 -0.078 _ATADDELSFK(gl)R_
GRB2 Ubiquitylation K69 -0.362 0.641 _AK(gl)AEEMLSK_
GRB2 Ubiquitylation K76 0.754 _AEEMLSK(gl)QR_
GRB2 Ubiquitylation K109 0.381 -0.002 _FGNDVQHFK(gl)VLR_
HRAS Ubiquitylation K170 -1.005 _K(gl)LNPPDESGPGCMSCK_
IGF1R Ubiquitylation K47 1.146 _NDYQQLK(gl)R_
IGF1R Ubiquitylation K1033 5.779 _VAIK(gl)TVNEAASMR_
IGF1R Ubiquitylation K1168 0.191 _K(gl)GGKGLLPVR_
IGF1R Ubiquitylation K1171 0.232 _GGK(gl)GLLPVR_
IRS1 Phosphorylation S1101 -0.078 _HSS(ph)ETFSSTPSATR_
IRS2 Phosphorylation S308 -0.079 -0.510 _SKS(ph)QSSGSSATHPISVPGAR_
IRS2 Phosphorylation T365 0.641 0.852 _T(ph)ASEGDGGAAAGAAAAGAR_
IRS2 Phosphorylation S367 0.757 0.612 _TAS(ph)EGDGGAAAGAAAAGAR_
IRS2 Phosphorylation S393 -1.580 -1.221 _PVSVAGSPLS(ph)PGPVR_
IRS2 Phosphorylation S520 0.359 -1.006 _S(ph)NTPESIAETPPAR_
IRS2 Phosphorylation T522 -1.103 -0.770 _SNT(ph)PESIAETPPAR_
IRS2 Phosphorylation T529 0.230 0.164 _S(ph)NTPESIAET(ph)PPAR_
IRS2 Phosphorylation S562 -0.026 0.439 _RVS(ph)GDAAQDLDR_
IRS2 Phosphorylation S579 0.542 0.362 _RTYS(ph)LTTPAR_
IRS2 Phosphorylation S621 -0.190 _LCPSCPAS(ph)SPK_
IRS2 Phosphorylation S622 -0.195 _LCPSCPASS(ph)PK_
IRS2 Phosphorylation S681 0.409 _SDDYM(ox)PM(ox)S(ph)PASVSAPK_
IRS2 Phosphorylation S732 -1.089 _AS(ph)SPAESSPEDSGYM(ox)R_
IRS2 Phosphorylation S733 -1.027 0.522 _ASS(ph)PAESSPEDSGYM(ox)R_
IRS2 Phosphorylation S738 0.522 _ASS(ph)PAESS(ph)PEDSGYMR_
IRS2 Phosphorylation S917 -0.592 -1.025 _S(ph)PGEYINIDFGEPGAR_
IRS2 Phosphorylation S1164 -0.499 _HSSETFSSTTTVTPVS(ph)PSFAHNPK_
IRS2 Phosphorylation S1178 0.766 0.277 _HNSAS(ph)VENVSLR_
IRS2 Phosphorylation T1204 -0.454 _SSEGGVGVGPGGGDEPPT(ph)SPR_
IRS2 Phosphorylation S1205 -0.291 _SSEGGVGVGPGGGDEPPTS(ph)PR_
NCK2 Phosphorylation S90 -0.317 0.054 _DAS(ph)PTPSTDAEYPANGSGADR_
PDPK1 Phosphorylation S241 0.358 0.361 _ANS(ph)FVGTAQYVSPELLTEK_
PDPK1 Ubiquitylation K257 0.571 -0.234 _ANSFVGTAQYVSPELLTEK(gl)SACK_
PIK3CA Ubiquitylation K864 0.390 0.588 _NSHTIM(ox)QIQCK(gl)GGLK_
PIK3CA Ubiquitylation K868 0.204 0.651 _NSHTIM(ox)QIQCKGGLK(gl)_
PIK3CA Ubiquitylation K974 -0.273 _GAQECTK(gl)TREFER_
PRKCD Ubiquitylation K138 -0.141 _SEDEAK(gl)FPTMNR_
PRKCD Ubiquitylation K222 0.185 0.658 _DTIFQK(gl)ER_
PRKCD Phosphorylation S302 -0.240 -0.222 _S(ph)DSASSEPVGIYQGFEK_
PRKCD Phosphorylation S304 0.378 0.289 _RSDS(ph)ASSEPVGIYQGFEK_
PRKCD Phosphorylation S506 -0.213 0.200 _AS(ph)TFCGTPDYIAPEILQGLK_
PRKCD Phosphorylation T507 -0.149 0.240 _AS(ph)TFCGTPDYIAPEILQGLK_
PRKCD Ubiquitylation K641 -2.000 _DYSNFDQEFLNEK(gl)AR_
PRKCD Phosphorylation S645 0.577 0.832 _ARLS(ph)YSDK_
PRKCD Phosphorylation S647 0.886 0.853 _ARLSYS(ph)DK_
PRKCZ Phosphorylation T560 -0.884 -1.578 _KQALPPFQPQITDDYGLDNFDTQFTSEPVQLT(ph)PDDEDAIKR_
PRKD1 Phosphorylation S207 0.941 1.048 _RLS(ph)NVSLTGVSTIR_
PRKD1 Phosphorylation T219 -0.068 -0.162 _T(ph)SSAELSTSAPDEPLLQK_
PRKD1 Phosphorylation S221 -0.662 -0.500 _TSS(ph)AELSTSAPDEPLLQK_
PRKD1 Phosphorylation S225 -0.970 -0.919 _TSSAELSTS(ph)APDEPLLSPVSPGFEQK_
PRKD1 Phosphorylation S236 -0.132 _TSSAELSTSAPDEPLLSPVS(ph)PGFEQK_
PRKD1 Phosphorylation S251 0.474 0.751 _SNS(ph)QSYIGRPIHLDK_
PRKD1 Phosphorylation S399 0.023 0.162 _TIS(ph)PSTSNNIPLMR_
PRKD1 Ubiquitylation K730 1.177 _IIGEK(gl)SFR_
PRKD1 Phosphorylation S744 -0.226 -0.287 _S(ph)VVGTPAYLAPEVLR_
PTPN1 Phosphorylation S352 0.032 _GS(ph)PLNAAPYGIESMSQDTEVR_
PTPN1 Phosphorylation S365 -0.247 0.956 _GSPLNAAPYGIESMS(ph)QDTEVR_
PTPN1 Phosphorylation S378 1.462 1.262 _VVGGS(ph)LR_
PTPN11 Ubiquitylation K124 0.562 _EAEK(gl)LLTEK_
PXN Phosphorylation S85 -0.156 0.192 _FIHQQPQSSS(ph)PVYGSSAK_
PXN Phosphorylation T136 1.322 _SAEPSPTVMST(ph)SLGSNLSELDR_
PXN Phosphorylation S140 -0.291 -0.948 _SAEPSPTVM(ox)STSLGS(ph)NLSELDR_
PXN Phosphorylation S302 -0.167 _S(ph)SPGGQDEGGFMAQGK_
PXN Phosphorylation S303 -0.167 _S(ph)SPGGQDEGGFMAQGK_
PXN Phosphorylation S322 -1.234 _TGSSS(ph)PPGGPPKPGSQLDSMLGSLQSDLNK_
RAF1 Phosphorylation S29 0.028 -0.571 _DAVFDGSSCIS(ph)PTIVQQFGYQR_
RAF1 Phosphorylation T31 0.028 -0.669 _DAVFDGSSCIS(ph)PTIVQQFGYQR_
RAF1 Phosphorylation S244 0.053 _YSTPHAFTFNTSS(ph)PSSEGSLSQR_
RAF1 Phosphorylation S259 -0.069 0.054 _STS(ph)TPNVHM(ox)VSTTLPVDSR_
RAF1 Phosphorylation S301 -0.651 _SHSESASPSALSSSPNNLS(ph)PTGWSQPK_
RAF1 Phosphorylation T303 -0.664 _SHSESASPSALSSSPNNLSPT(ph)GWSQPK_
RAF1 Phosphorylation S497 -0.449 _SRWS(ph)GSQQVEQPTGSVLWMAPEVIR_
RAF1 Phosphorylation S621 0.212 0.271 _SAS(ph)EPSLHR_
RAF1 Phosphorylation S642 -0.197 0.463 _AAHTEDINACTLTTS(ph)PR_
RPS6KB1 Ubiquitylation K99 -0.316 _VLGK(gl)GGYGK_
RPS6KB1 Phosphorylation S447 -0.525 -0.458 _TPVS(ph)PVKFSPGDFWGR_
SOS1 Phosphorylation S1082 0.278 _IPESETESTASAPNS(ph)PR_
SOS1 Phosphorylation S1166 0.097 -0.094 _RPESAPAES(ph)SPSK_
YWHAE Ubiquitylation K38 0.710 1.822 _YDEMVESMK(gl)K_
YWHAE Ubiquitylation K39 1.734 _YDEMVESMKK(gl)_
YWHAE Ubiquitylation K60 0.554 1.732 _NLLSVAYK(gl)NVIGAR_
YWHAE Ubiquitylation K83 0.375 0.643 _IISSIEQKEENK(gl)GGEDKLK_
YWHAE Ubiquitylation K90 1.103 _GGEDKLK(gl)MIR_
YWHAE Ubiquitylation K116 -0.289 _LICCDILDVLDK(gl)HLIPAANTGESK_
YWHAE Ubiquitylation K133 0.653 1.264 _VFYYK(gl)M(ox)K_
YWHAE Ubiquitylation K152 0.031 0.601 _K(gl)EAAENSLVAYK_
YWHAE Phosphorylation S210 0.534 0.506 _AAFDDAIAELDTLS(ph)EESYK_
YWHAE Phosphorylation S213 0.541 _AAFDDAIAELDTLSEES(ph)YK_
YWHAZ Ubiquitylation K3 0.268 0.388 _(ac)MDK(gl)NELVQK_
YWHAZ Ubiquitylation K9 0.917 0.954 _(ac)MDKNELVQK(gl)AK_
YWHAZ Ubiquitylation K11 0.016 0.388 _AK(gl)LAEQAERYDDMAACMK_
YWHAZ Ubiquitylation K49 0.656 1.019 _NLLSVAYK(gl)NVVGAR_
YWHAZ Ubiquitylation K68 0.504 _VVSSIEQK(gl)TEGAEK_
YWHAZ Ubiquitylation K74 0.762 _VVSSIEQKTEGAEK(gl)K_
YWHAZ Ubiquitylation K85 -0.089 _EK(gl)IETELR_
YWHAZ Ubiquitylation K122 0.498 0.837 _MK(gl)GDYYR_
YWHAZ Ubiquitylation K138 0.560 1.003 _YLAEVAAGDDK(gl)K_
YWHAZ Ubiquitylation K139 0.551 1.003 _YLAEVAAGDDKK(gl)_
YWHAZ Ubiquitylation K166 -0.439 -0.371 _K(gl)EMQPTHPIR_


© Copyright Svejstrup Laboratory 2015