bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
REACTOME_GAB1_SIGNALOSOME
(Pathway_549)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
GSK3A 2 -1.420 1.510 -1.128 1.091
GSK3A 2 -1.420 1.510
AKT3 2 0.580 -0.030 -0.194
AKT3 2 0.580 -0.030
FOXO3 2 -0.410 -0.120
TSC2 1 0.810 -0.710
TSC2 1 0.810 -0.710 -0.715
RICTOR 1 -0.330 0.710
RICTOR 1 -0.270 0.570
BAD 0 -0.660 1.190
PAG1 0 -0.550 1.760
CSK 0 1.200 -0.960 -1.211
CSK 0 1.200 -0.960
AKT2 0 -1.420 2.210 -0.194
GAB1 0 1.950 -1.110
CREB1 0 1.080 -0.800 -1.027
MAPKAP1 0 -0.450 1.350
PIK3CA 0
CDKN1A 0 1.080 -0.750
MDM2 0 -0.210 0.080
PDPK1 0 0.050 -0.440
AKT1 0 -0.050 0.700
AKT1 0 0.860 -0.040
PIK3R1 0 1.910 -1.220 -0.441 0.147
EGFR 0 -0.580 0.520 0.513 0.090
MLST8 0 -0.170 0.220
RPS6KB2 0 -1.260 2.030
GRB2 0 -0.240 0.300 -1.021 0.057 0.906
SRC 0 0.050 0.470 -0.031
MTOR 0 -0.680 0.150 0.757 0.074 0.101
AKT1S1 0 -0.070 -0.260
CHUK 0 -0.480

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
AKT1 Phosphorylation S124 0.252 0.311 _SGS(ph)PSDNSGAEEMEVSLAKPK_
AKT1 Phosphorylation S126 -0.241 _SGSPS(ph)DNSGAEEM(ox)EVSLAK_
AKT1 Ubiquitylation K301 0.988 _EGIK(gl)DGATMK_
AKT1S1 Phosphorylation S88 -2.758 -2.516 _AATAARPPAPPPAPQPPS(ph)PTPS(ph)PPRPTLAR_
AKT1S1 Phosphorylation S92 -3.077 -3.065 _AATAARPPAPPPAPQPPS(ph)PTPS(ph)PPRPTLAR_
AKT1S1 Phosphorylation T97 -3.450 _AATAARPPAPPPAPQPPS(ph)PTPSPPRPT(ph)LAR_
AKT1S1 Phosphorylation S183 -0.539 -0.207 _S(ph)LPVSVPVWGFK_
AKT1S1 Phosphorylation S203 -0.783 -0.726 _SS(ph)DEENGPPSS(ph)PDLDR_
AKT1S1 Phosphorylation S211 -0.801 -1.311 _SS(ph)DEENGPPS(ph)SPDLDR_
AKT1S1 Phosphorylation S212 0.721 -1.311 _SS(ph)DEENGPPSS(ph)PDLDR_
AKT1S1 Phosphorylation T246 0.502 0.358 _LNT(ph)SDFQK_
AKT2 Ubiquitylation K14 0.306 0.070 _EGWLHK(gl)R_
AKT2 Ubiquitylation K111 1.082 _AIQMVANSLK(gl)QR_
AKT2 Ubiquitylation K160 0.251 _LLGK(gl)GTFGK_
AKT2 Phosphorylation T451 -0.091 -0.612 _YFDDEFTAQSITIT(ph)PPDRYDSLGLLELDQR_
AKT2 Phosphorylation Y456 -0.265 _YFDDEFTAQSITITPPDRY(ph)DSLGLLELDQR_
AKT3 Ubiquitylation K14 0.306 0.070 _EGWLHK(gl)R_
AKT3 Ubiquitylation K14 4.941 5.277 _EGWVQK(gl)R_
AKT3 Ubiquitylation K111 1.082 _AIQMVANSLK(gl)QR_
AKT3 Phosphorylation S120 1.097 _MNCS(ph)PTSQIDNIGEEEMDASTTHHK_
AKT3 Ubiquitylation K160 0.251 _LLGK(gl)GTFGK_
AKT3 Phosphorylation T451 -0.091 -0.612 _YFDDEFTAQSITIT(ph)PPDRYDSLGLLELDQR_
AKT3 Phosphorylation Y456 -0.265 _YFDDEFTAQSITITPPDRY(ph)DSLGLLELDQR_
BAD Phosphorylation S74 -0.904 -0.452 _HS(ph)SYPAGTEDDEGM(ox)GEEPSPFR_
BAD Phosphorylation S75 -0.914 -0.660 _HSS(ph)YPAGTEDDEGMGEEPSPFR_
BAD Phosphorylation S97 0.056 _S(ph)RSAPPNLWAAQR_
BAD Phosphorylation S99 -0.299 0.161 _S(ph)APPNLWAAQR_
BAD Phosphorylation S118 1.277 1.089 _RM(ox)S(ph)DEFVDSFKK_
CDKN1A Ubiquitylation K188 -2.505 -1.077 _QTSMTDFYHSK(gl)R_
CHUK Ubiquitylation K296 -1.637 _GGPVDLTLK(gl)QPR_
CREB1 Phosphorylation S271 -0.979 -1.450 _TAPTSTIAPGVVM(ox)ASS(ph)PALPTQPAEEAAR_
CREB1 Ubiquitylation K333 1.343 _ALK(gl)DLYCHK_
CSK Ubiquitylation K196 -0.133 _SGWALNMKELK(gl)_
EGFR Phosphorylation T693 0.486 -0.139 _ELVEPLT(ph)PSGEAPNQALLR_
EGFR Phosphorylation S991 -0.041 _MHLPS(ph)PTDSNFYR_
FOXO3 Phosphorylation S12 -1.324 _(ac)AEAPASPAPLS(ph)PLEVELDPEFEPQSRPR_
FOXO3 Phosphorylation S253 2.510 _AVS(ph)MDNSNKYTK_
FOXO3 Phosphorylation S284 4.138 6.011 _AALQTAPESADDS(ph)PSQLSK_
FOXO3 Phosphorylation S421 1.295 _GS(ph)GLGSPTSSFNSTVFGPSSLNSLR_
FOXO3 Phosphorylation S425 1.471 _GSGLGS(ph)PTSSFNSTVFGPSSLNSLR_
GAB1 Phosphorylation S266 0.756 0.551 _SYS(ph)HDVLPK_
GAB1 Phosphorylation S367 0.230 0.176 _TAS(ph)DTDSSYCIPTAGMS(ph)PSR_
GAB1 Phosphorylation T369 -0.352 _TASDT(ph)DSSYCIPTAGMS(ph)PSR_
GAB1 Phosphorylation S381 -0.481 0.139 _TASDTDSSYCIPTAGM(ox)S(ph)PSR_
GAB1 Phosphorylation S401 0.266 0.788 _DAS(ph)SQDCYDIPR_
GAB1 Phosphorylation S402 0.328 0.633 _DASS(ph)QDCYDIPR_
GAB1 Phosphorylation S419 0.540 _SSS(ph)LEGFHNHFK_
GRB2 Ubiquitylation K10 0.146 _YDFK(gl)ATADDELSFK_
GRB2 Ubiquitylation K20 -0.078 _ATADDELSFK(gl)R_
GRB2 Ubiquitylation K69 -0.362 0.641 _AK(gl)AEEMLSK_
GRB2 Ubiquitylation K76 0.754 _AEEMLSK(gl)QR_
GRB2 Ubiquitylation K109 0.381 -0.002 _FGNDVQHFK(gl)VLR_
GSK3A Phosphorylation S9 -0.483 0.010 _TTS(ph)FAESCKPVQQPSAFGSMK_
GSK3A Phosphorylation S21 -0.406 _TSS(ph)FAEPGGGGGGGGGGPGGSASGPGGTGGGK_
GSK3A Ubiquitylation K85 -0.204 _LCDSGELVAIK(gl)K_
GSK3A Ubiquitylation K86 -0.204 _LCDSGELVAIK(gl)K_
GSK3A Ubiquitylation K148 0.396 _ELVAIK(gl)K_
GSK3A Phosphorylation S215 0.296 0.477 _GEPNVS(ph)YICSR_
GSK3A Phosphorylation Y216 0.356 0.376 _GEPNVSY(ph)ICSR_
GSK3A Phosphorylation T390 2.800 2.527 _IQAAAST(ph)PTNATAASDANTGDR_
MAPKAP1 Phosphorylation T509 1.075 _RT(ph)SFSFQK_
MAPKAP1 Phosphorylation S510 1.045 1.169 _RTS(ph)FSFQK_
MDM2 Phosphorylation S166 0.576 1.068 _AIS(ph)ETEENSDELSGER_
MDM2 Ubiquitylation K334 -0.872 _ENWLPEDK(gl)GK_
MDM2 Ubiquitylation K336 -0.872 _ENWLPEDK(gl)GK_
MDM2 Ubiquitylation K363 0.883 _LENSTQAEEGFDVPDCK(gl)K_
MDM2 Ubiquitylation K364 0.883 _LENSTQAEEGFDVPDCK(gl)K_
MDM2 Ubiquitylation K473 0.806 _NK(gl)PCPVCR_
MLST8 Phosphorylation T3 -0.481 _(ac)MNT(ph)SPGTVGSDPVILATAGYDHTVR_
MLST8 Ubiquitylation K245 -0.114 0.462 _FSPDSTLLATCSADQTCK(gl)IWR_
MTOR Ubiquitylation K309 -0.762 0.065 _DLMGFGTK(gl)PR_
MTOR Ubiquitylation K1257 -1.167 -0.901 _SGQGDALASGPVETGPMKK(gl)_
MTOR Ubiquitylation K1395 -1.255 _AYAK(gl)ALHYK_
MTOR Ubiquitylation K2066 -1.004 _GPQTLK(gl)ETSFNQAYGR_
MTOR Ubiquitylation K2166 -1.304 _IQSIAPSLQVITSK(gl)QRPR_
MTOR Phosphorylation T2471 0.329 _KT(ph)GTTVPESIHSFIGDGLVKPEALNK_
PAG1 Phosphorylation S288 0.574 0.875 _EGGEAEESATDTTS(ph)ETNK_
PDPK1 Phosphorylation S241 0.358 0.361 _ANS(ph)FVGTAQYVSPELLTEK_
PDPK1 Ubiquitylation K257 0.571 -0.234 _ANSFVGTAQYVSPELLTEK(gl)SACK_
PIK3CA Ubiquitylation K864 0.390 0.588 _NSHTIM(ox)QIQCK(gl)GGLK_
PIK3CA Ubiquitylation K868 0.204 0.651 _NSHTIM(ox)QIQCKGGLK(gl)_
PIK3CA Ubiquitylation K974 -0.273 _GAQECTK(gl)TREFER_
RICTOR Phosphorylation S21 -0.279 0.249 _NDS(ph)GEENVPLDLTR_
RICTOR Ubiquitylation K830 -0.874 _GYVAKQLEK(gl)_
RICTOR Phosphorylation S1284 2.625 _SNS(ph)VSLVPPGSSHTLPR_
RICTOR Phosphorylation S1302 -0.560 0.260 _RAQS(ph)LKAPSIATIK_
RICTOR Phosphorylation S1388 0.507 _ALSYAS(ph)LDKEDLLSPINQNTLQR_
RPS6KB2 Ubiquitylation K99 -0.316 _VLGK(gl)GGYGK_
SRC Phosphorylation S17 -0.604 -0.689 _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_
SRC Phosphorylation S75 0.060 0.331 _LFGGFNSSDTVTS(ph)PQR_
TSC2 Ubiquitylation K3 -1.397 _(ac)AK(gl)PTSKDSGLK_
TSC2 Ubiquitylation K14 -1.297 _DSGLKEK(gl)FK_
TSC2 Ubiquitylation K69 0.051 _MIGQICEVAK(gl)TK_
TSC2 Ubiquitylation K71 -0.157 _MIGQICEVAKTK(gl)_
TSC2 Ubiquitylation K258 -0.278 _ELCEPCWK(gl)LMR_
TSC2 Ubiquitylation K634 1.610 _LGLPNK(gl)DGVVR_
TSC2 Phosphorylation S950 -0.152 -0.529 _STS(ph)LNERPK_
TSC2 Phosphorylation S1064 -0.927 _SLLGLDSGELQSGPESSSS(ph)PGVHVR_
TSC2 Phosphorylation S1248 -0.604 _SNTDSAVVMEEGS(ph)PGEVPVLVEPPGLEDVEAALGMDRR_
TSC2 Phosphorylation S1329 -0.120 _S(ph)SSSPELQTLQDILGDPGDK_
TSC2 Phosphorylation S1331 -0.262 _SSS(ph)SPELQTLQDILGDPGDKADVGR_
TSC2 Phosphorylation S1332 -0.063 _SSSS(ph)PELQTLQDILGDPGDK_
TSC2 Phosphorylation S1355 0.174 0.351 _ADVGRLS(ph)PEVK_
TSC2 Phosphorylation S1362 0.859 _S(ph)QSGTLDGESAAWSASGEDSR_
TSC2 Phosphorylation S1364 0.522 0.550 _SQS(ph)GTLDGESAAWSASGEDSR_
TSC2 Phosphorylation T1366 0.137 _SQSGT(ph)LDGESAAWSASGEDSR_
TSC2 Phosphorylation S1396 0.498 _S(ph)PSGLRPR_
TSC2 Phosphorylation S1743 0.596 _RLISS(ph)VEDFTEFV_


© Copyright Svejstrup Laboratory 2015