bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
KEGG_MISMATCH_REPAIR
(Pathway_341)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
RPA1 6 0.500 0.350 3.133 3.046 0.303 1.770 2.112
RFC1 3 2.530 -1.230 0.635 1.060 1.028 0.826
RPA3 3 -0.760 1.900 1.805
RPA2 3 -1.830 3.700 1.524
RPA2 3 -1.830 3.700 2.592
MSH6 2 -0.410 0.140 -0.115 0.232 0.645 0.407 0.101
PCNA 2 -0.730 0.380 0.679 1.154 0.572 0.718 0.782
MSH2 1 -0.130 0.010 0.224 0.457 0.838 0.840 0.366
POLD1 0 1.600 -1.300 -0.932 0.362 0.283
POLD1 0 1.600 -1.300
MLH1 0 -0.460 0.110 -0.360 1.227 1.219
POLD3 0 -0.343
LIG1 0 0.370 -0.580
SSBP1 0 0.580 -0.460 0.755 0.990 -0.115
SSBP1 0 0.580 -0.460
POLD2 0 -0.020 0.200 0.123
RFC5 0 0.500 -0.920
RFC5 0 0.500 -0.920 -1.112 -0.547 0.316 -0.391 0.586
MSH3 0 0.890 -0.360 -0.771 0.719 0.629 0.421 0.240
PMS2 0 0.410 -0.450
RFC3 0 0.010 -0.490 0.265 -0.461 0.387 0.658 0.371
RFC4 0 1.100 -0.890 -0.721 -0.389 0.425 -0.194 0.037
EXO1 0 0.890 -0.810

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
EXO1 Phosphorylation S598 0.826 _TIS(ph)PPTLGTLR_
LIG1 Phosphorylation S49 0.101 _EWNGVVSES(ph)DSPVK_
LIG1 Phosphorylation S51 0.145 -0.066 _EWNGVVSESDS(ph)PVK_
LIG1 Phosphorylation S66 0.671 0.408 _VLGS(ph)EGEEEDEALSPAK_
LIG1 Phosphorylation S76 -0.083 0.108 _VLGSEGEEEDEALS(ph)PAK_
LIG1 Phosphorylation S88 1.273 _GQKPALDCS(ph)QVSPPRPATSPENNASLSDTSPMDSSPSGIPK_
LIG1 Phosphorylation S141 0.697 0.877 _TIQEVLEEQS(ph)EDEDREAK_
LIG1 Phosphorylation T182 -0.768 -0.709 _EGEDGDQPT(ph)TPPKPLK_
LIG1 Phosphorylation T183 -0.923 -0.825 _EGEDGDQPTT(ph)PPKPLK_
LIG1 Phosphorylation T195 0.021 0.224 _AET(ph)PTESVS(ph)EPEVATK_
LIG1 Phosphorylation T197 0.441 0.125 _AETPT(ph)ESVSEPEVATK_
LIG1 Phosphorylation S199 0.721 _AET(ph)PTES(ph)VSEPEVATK_
LIG1 Phosphorylation S201 -0.213 0.070 _AET(ph)PTESVS(ph)EPEVATK_
MSH2 Ubiquitylation K212 -0.233 _ECVLPGGETAGDMGK(gl)LR_
MSH2 Ubiquitylation K249 0.461 _K(gl)GEQMNSAVLPEMENQVAVSSLSAVIK_
MSH2 Ubiquitylation K347 2.867 _LVNQWIK(gl)QPLMDK_
MSH2 Ubiquitylation K531 1.040 _VTCKEEK(gl)VLR_
MSH2 Ubiquitylation K555 0.164 _FTNSK(gl)LTSLNEEYTK_
MSH2 Ubiquitylation K635 -0.376 _IILK(gl)ASR_
MSH6 Phosphorylation S41 -0.708 -0.948 _AAAAPGAS(ph)PSPGGDAAWSEAGPGPRPLAR_
MSH6 Phosphorylation S43 0.319 -0.234 _AAAAPGASPS(ph)PGGDAAWSEAGPGPR_
MSH6 Phosphorylation S137 0.203 0.359 _VHVQFFDDS(ph)PTR_
MSH6 Phosphorylation T139 0.209 _VHVQFFDDSPT(ph)R_
MSH6 Phosphorylation S227 -0.199 -0.192 _SEEDNEIES(ph)EEEVQPK_
MSH6 Ubiquitylation K334 0.193 _QATSISSETK(gl)NTLR_
MSH6 Ubiquitylation K476 1.536 0.184 _YSDSLVQK(gl)GYK_
MSH6 Ubiquitylation K519 2.264 0.186 _IITK(gl)GTQTYSVLEGDPSENYSK_
MSH6 Ubiquitylation K728 0.082 -0.280 _SGAIFTK(gl)AYQR_
MSH6 Ubiquitylation K771 -0.582 -1.069 _VDTCHTPFGK(gl)R_
MSH6 Phosphorylation S830 0.130 1.666 _IHNVGS(ph)PLK_
MSH6 Ubiquitylation K852 -0.044 _AIMYEETTYSK(gl)K_
MSH6 Ubiquitylation K853 -0.044 _AIMYEETTYSK(gl)K_
MSH6 Ubiquitylation K896 -0.342 _QVISLQTK(gl)NPEGR_
MSH6 Ubiquitylation K997 -0.863 _NLPEEYELK(gl)STK_
MSH6 Ubiquitylation K1009 -0.817 _YWTK(gl)TIEK_
MSH6 Ubiquitylation K1030 0.394 -0.156 _DVSLK(gl)DCMR_
MSH6 Ubiquitylation K1240 -0.672 _ELAETIK(gl)CR_
MSH6 Ubiquitylation K1291 0.633 _FIK(gl)GACPK_
MSH6 Ubiquitylation K1296 -1.142 _GACPK(gl)SYGFNAAR_
MSH6 Ubiquitylation K1315 -1.738 _LANLPEEVIQK(gl)GHR_
MSH6 Ubiquitylation K1325 -0.190 _EFEK(gl)MNQSLR_
PCNA Ubiquitylation K13 0.209 2.207 _LVQGSILK(gl)K_
PCNA Ubiquitylation K14 0.233 2.833 _LVQGSILKK(gl)_
PCNA Ubiquitylation K80 0.570 1.579 _ILK(gl)CAGNEDIITLR_
PCNA Ubiquitylation K164 2.309 2.671 _DLSHIGDAVVISCAK(gl)DGVK_
PCNA Ubiquitylation K168 2.484 2.645 _DLSHIGDAVVISCAKDGVK(gl)_
PCNA Ubiquitylation K248 0.226 0.515 _IADMGHLK(gl)YYLAPK_
PMS2 Ubiquitylation K146 -0.403 _IIQK(gl)TPYPRPR_
POLD1 Ubiquitylation K414 -1.315 _AQTLK(gl)VQTFPFLGR_
POLD1 Ubiquitylation K439 -1.108 _DSSFQSK(gl)QTGRR_
POLD1 Ubiquitylation K447 -1.286 _DTK(gl)VVSMVGR_
POLD1 Ubiquitylation K554 -0.798 _GQQVK(gl)VVSQLLR_
POLD1 Ubiquitylation K674 -1.082 -1.843 _TPTGDEFVK(gl)TSVR_
POLD1 Ubiquitylation K758 -0.638 _TK(gl)QLVESK_
POLD1 Ubiquitylation K853 -0.080 -1.776 _MDCK(gl)GLEAVR_
POLD1 Ubiquitylation K911 -0.089 -0.915 _IDISQLVITK(gl)ELTR_
POLD1 Ubiquitylation K923 -2.496 _AASDYAGK(gl)QAHVELAER_
POLD1 Ubiquitylation K1033 0.475 -0.930 _VGGLLAFAK(gl)R_
POLD1 Ubiquitylation K1065 -0.208 _ESELYQK(gl)EVSHLNALEER_
POLD2 Phosphorylation S15 -1.104 _AHTLLS(ph)PPSANNATFAR_
POLD2 Ubiquitylation K81 -0.936 _AQQHWGSGVGVKK(gl)_
POLD2 Ubiquitylation K145 0.215 _LK(gl)GTIDVSK_
POLD2 Ubiquitylation K267 -0.443 -0.428 _K(gl)TQAASVEAVK_
POLD3 Phosphorylation S307 0.831 0.828 _VALS(ph)DDETKETENMR_
RFC1 Phosphorylation S156 -0.050 0.188 _NKPLS(ph)PIK_
RFC1 Phosphorylation T161 2.131 1.586 _NKPLS(ph)PIKLT(ph)PTSVLDYFGTGSVQR_
RFC1 Phosphorylation T163 1.551 _NKPLS(ph)PIKLTPT(ph)SVLDYFGTGSVQR_
RFC1 Phosphorylation S190 2.756 2.241 _ELS(ph)QNTDESGLNDEAIAK_
RFC1 Ubiquitylation K240 0.991 _TLAMLDEEPKTKK(gl)_
RFC1 Ubiquitylation K271 0.551 _VK(gl)TAQVSDERK_
RFC1 Phosphorylation S368 0.431 0.440 _KESVS(ph)PEDSEK_
RFC1 Ubiquitylation K436 -0.227 _YGGK(gl)VTGNVSK_
RFC1 Ubiquitylation K498 0.781 _SKYEIAVETEMK(gl)K_
RFC1 Ubiquitylation K499 0.781 _SKYEIAVETEMK(gl)K_
RFC3 Ubiquitylation K66 -1.522 _ELYGVGVEK(gl)LR_
RFC3 Ubiquitylation K80 -1.498 -2.261 _IEHQTITTPSKK(gl)_
RFC3 Ubiquitylation K154 -1.667 -0.110 _TMEK(gl)YMSTCR_
RFC3 Ubiquitylation K170 -1.470 -0.431 _LILCCNSTSK(gl)VIPPIR_
RFC3 Ubiquitylation K202 -0.332 -0.849 _K(gl)EGLNLPSQLAHR_
RFC3 Ubiquitylation K225 -0.218 _K(gl)ALLMCEACR_
RFC4 Ubiquitylation K205 0.306 _FKPLSDK(gl)IQQQR_
RFC4 Ubiquitylation K217 -0.818 _LLDIAKK(gl)_
RFC4 Ubiquitylation K240 0.204 _K(gl)AITFLQSATR_
RFC5 Ubiquitylation K16 0.039 -0.820 _QQEQPAATK(gl)IR_
RFC5 Ubiquitylation K270 0.495 _NITELK(gl)TLK_
RPA1 Ubiquitylation K163 2.827 4.085 _AYGASK(gl)TFGK_
RPA1 Ubiquitylation K167 3.009 3.243 _TFGK(gl)AAGPSLSHTSGGTQSK_
RPA1 Ubiquitylation K183 0.925 _AAGPSLSHTSGGTQSK(gl)VVPIASLTPYQSK_
RPA1 Ubiquitylation K263 -1.803 _GTLK(gl)IANK_
RPA1 Ubiquitylation K267 2.751 _IANK(gl)QFTAVK_
RPA1 Ubiquitylation K331 3.112 4.066 _SYEDATK(gl)ITVR_
RPA1 Ubiquitylation K410 2.458 _SLSVLSSSTIIANPDIPEAYK(gl)LR_
RPA1 Ubiquitylation K489 0.465 2.335 _K(gl)VIDQQNGLYR_
RPA1 Ubiquitylation K588 -0.055 _IK(gl)ATVMDVKPVDYR_
RPA1 Ubiquitylation K595 1.201 _ATVMDVK(gl)PVDYR_
RPA2 Ubiquitylation K85 0.693 _HAEK(gl)APTNIVYK_
RPA2 Ubiquitylation K235 1.339 _NQLK(gl)HMSVSSIK_
RPA3 Ubiquitylation K33 0.794 _LEK(gl)IHPTGK_
RPA3 Ubiquitylation K39 1.508 1.875 _IHPTGK(gl)MFILSDGEGK_
SSBP1 Ubiquitylation K103 0.616 _DVAYQYVK(gl)K_
SSBP1 Ubiquitylation K104 0.616 _DVAYQYVK(gl)K_


© Copyright Svejstrup Laboratory 2015