bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
spliceosomal snRNP assembly
(GO:0000387)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
DDX20 2 -1.700 3.260 -0.911 -0.594 -0.404
DDX20 2 -1.700 3.260 -1.460
GEMIN8 1 -0.860 1.150
SNRPD2 1 -1.740 2.880 0.068 -0.598 0.211 0.010 0.140
SART1 1 -1.750 3.220 0.251 -0.597 0.017 -0.223 0.146
GEMIN4 1 0.410 0.040 -0.361 0.231
GEMIN4 1 0.410 0.040 -0.166 -0.019
CLNS1A 0 -1.140 1.450 -0.181 -0.106
GEMIN5 0 -0.600 0.630 0.117 -0.284 0.165 0.034
GEMIN2 0 0.620 -0.610
SNRPD3 0 -0.044 -0.427 0.192
PRMT5 0 0.330 -0.190 -0.234 0.169
PRMT5 0 0.330 -0.190 0.437 -0.333 -0.138
NCBP2 0 -0.700 0.840 0.520 0.032 1.096 -0.957
WDR77 0 -0.190 1.540 0.322 -0.304 0.069 0.907 -1.325
SNRPC 0 -0.200 0.800 -0.392 0.470 0.128 -0.891
SNRPB 0 -0.690 0.900 0.279 -0.218 0.342 0.246 0.550
NCBP1 0 -0.510 0.770 1.020 -0.130 0.769 -0.383 0.710
TGS1 0 0.840 -0.360
SNRPF 0 -0.086 -0.877 -0.179 -0.438 0.348
GEMIN7 0 -0.480 0.570
SNRPG 0 -0.190 -0.311 0.245 0.156 0.568
SNRPG 0
PHAX 0 1.210 -0.880
SNRPD1 0 -0.780 0.750 0.034 -0.359 0.355 -1.109 -0.252
SNUPN 0 -0.890 1.620
SMN1 0 -1.430 1.720 0.023 0.246 -1.731
SMN1 0 -0.560 0.640 0.023 0.246 -1.731
SMN2 0 0.023 0.246 -1.731
SNRPE 0 -1.140 2.270 -0.259 -0.638 -0.181 0.064 -0.174

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
CLNS1A Phosphorylation S102 -0.365 -0.345 _FEEESKEPVADEEEEDS(ph)DDDVEPITEFR_
DDX20 Phosphorylation S268 1.509 _LNS(ph)SDPSLIGLK_
DDX20 Ubiquitylation K356 0.817 -0.217 _LDAMAKLK(gl)_
DDX20 Phosphorylation T531 0.063 0.240 _AT(ph)SPKELGCDR_
DDX20 Phosphorylation S532 -1.143 -0.447 _ATS(ph)PKELGCDR_
DDX20 Phosphorylation S714 -0.225 0.002 _YQES(ph)PGIQM(ox)K_
DDX20 Ubiquitylation K720 -1.179 _YQESPGIQMK(gl)TR_
GEMIN2 Phosphorylation S81 -0.444 _KQS(ph)VNISLSGCQPAPEGYSPTLQWQQQQVAQFSTVR_
GEMIN4 Phosphorylation S205 1.824 _LRS(ph)DPDACPTMPLLAMLLR_
GEMIN5 Ubiquitylation K247 0.401 0.315 _GCYLATGSK(gl)DQTIR_
GEMIN5 Phosphorylation S757 0.709 0.622 _LES(ph)IDGNEEESM(ox)K_
GEMIN5 Ubiquitylation K817 -0.858 _EPVICTPVSSGFEKSK(gl)_
GEMIN5 Ubiquitylation K1187 -1.376 _LQNIK(gl)YPSATNNTPAK_
GEMIN5 Ubiquitylation K1363 0.002 _ELFSEK(gl)HASLQNSQR_
GEMIN7 Phosphorylation T3 -0.301 0.164 _(ac)M(ox)QT(ph)PVNIPVPVLR_
GEMIN8 Ubiquitylation K5 -0.024 0.779 _(ac)AAVK(gl)ASTSK_
GEMIN8 Phosphorylation S185 4.272 _S(ph)VEAPTERPGER_
NCBP1 Phosphorylation T21 0.500 1.259 _KT(ph)SDANETEDHLESLICK_
NCBP1 Phosphorylation S22 1.091 1.381 _KTS(ph)DANETEDHLESLICK_
NCBP1 Ubiquitylation K204 0.269 _IFANTESYLK(gl)R_
NCBP2 Ubiquitylation K7 -1.025 _(ac)SGGLLK(gl)ALR_
PHAX Phosphorylation S368 1.123 0.729 _ETFASDTNEALASLDES(ph)QEGHAEAK_
PRMT5 Ubiquitylation K60 -1.551 -1.863 _EFIQEPAK(gl)NRPGPQTR_
PRMT5 Ubiquitylation K95 0.070 -1.206 _LSPWIRPDSK(gl)VEK_
PRMT5 Ubiquitylation K200 0.125 0.439 _TLCDYSK(gl)R_
PRMT5 Ubiquitylation K240 -1.218 _AAILPTSIFLTNK(gl)K_
PRMT5 Ubiquitylation K241 -1.002 _AAILPTSIFLTNKK(gl)_
PRMT5 Ubiquitylation K387 0.290 _IK(gl)LYAVEK_
SART1 Phosphorylation S448 1.013 -0.132 _RVS(ph)EVEEEKEPVPQPLPSDDTR_
SMN1 Phosphorylation S4 0.158 0.444 _(ac)AMS(ph)SGGSGGGVPEQEDSVLFR_
SMN1 Phosphorylation S5 0.453 0.382 _(ac)AMSS(ph)GGSGGGVPEQEDSVLFR_
SMN1 Phosphorylation S8 0.239 0.738 _(ac)AMSSGGS(ph)GGGVPEQEDSVLFR_
SMN1 Phosphorylation T25 1.306 0.581 _GT(ph)GQSDDSDIWDDTALIK_
SMN1 Phosphorylation S28 0.885 0.944 _GTGQS(ph)DDSDIWDDTALIK_
SMN1 Phosphorylation S31 0.980 _RGTGQSDDS(ph)DIWDDTALIK_
SMN1 Ubiquitylation K45 0.101 1.114 _AYDK(gl)AVASFK_
SMN1 Ubiquitylation K51 -0.448 _AVASFK(gl)HALK_
SMN1 Ubiquitylation K65 -0.724 _NGDICETSGK(gl)PK_
SMN1 Ubiquitylation K83 -0.049 -0.330 _K(gl)NTAASLQQWK_
SMN1 Ubiquitylation K93 0.896 _NTAASLQQWK(gl)VGDK_
SMN1 Ubiquitylation K179 -1.678 _SPGNK(gl)SDNIKPK_
SMN1 Ubiquitylation K209 -0.581 -0.285 _LGPGK(gl)PGLK_
SMN2 Phosphorylation S4 0.158 0.444 _(ac)AMS(ph)SGGSGGGVPEQEDSVLFR_
SMN2 Phosphorylation S5 0.453 0.382 _(ac)AMSS(ph)GGSGGGVPEQEDSVLFR_
SMN2 Phosphorylation S8 0.239 0.738 _(ac)AMSSGGS(ph)GGGVPEQEDSVLFR_
SMN2 Phosphorylation T25 1.306 0.581 _GT(ph)GQSDDSDIWDDTALIK_
SMN2 Phosphorylation S28 0.885 0.944 _GTGQS(ph)DDSDIWDDTALIK_
SMN2 Phosphorylation S31 0.980 _RGTGQSDDS(ph)DIWDDTALIK_
SMN2 Ubiquitylation K45 0.101 1.114 _AYDK(gl)AVASFK_
SMN2 Ubiquitylation K51 -0.448 _AVASFK(gl)HALK_
SMN2 Ubiquitylation K65 -0.724 _NGDICETSGK(gl)PK_
SMN2 Ubiquitylation K83 -0.049 -0.330 _K(gl)NTAASLQQWK_
SMN2 Ubiquitylation K93 0.896 _NTAASLQQWK(gl)VGDK_
SMN2 Ubiquitylation K179 -1.678 _SPGNK(gl)SDNIKPK_
SMN2 Ubiquitylation K209 -0.581 -0.285 _LGPGK(gl)PGLK_
SNRPB Ubiquitylation K8 0.805 _SSK(gl)MLQHIDYR_
SNRPB Ubiquitylation K32 0.987 _IFIGTFK(gl)_
SNRPB Ubiquitylation K88 -0.870 _GENLVSMTVEGPPPK(gl)DTGIAR_
SNRPC Ubiquitylation K3 -0.162 _PK(gl)FYCDYCDTYLTHDSPSVR_
SNRPC Phosphorylation S17 -0.713 0.002 _FYCDYCDTYLTHDS(ph)PSVR_
SNRPC Phosphorylation S19 0.125 _FYCDYCDTYLTHDSPS(ph)VRK_
SNRPC Ubiquitylation K35 0.999 _ENVK(gl)DYYQK_
SNRPD1 Ubiquitylation K44 0.032 _AVK(gl)MTLK_
SNRPD2 Phosphorylation S2 -0.117 0.507 _(ac)S(ph)LLNKPK_
SNRPD2 Ubiquitylation K6 -0.352 _(ac)SLLNK(gl)PK_
SNRPD2 Ubiquitylation K8 -0.201 -0.603 _(ac)SLLNKPK(gl)SEMTPEELQK_
SNRPD2 Phosphorylation T12 0.766 _SEMT(ph)PEELQKR_
SNRPD2 Ubiquitylation K98 0.883 0.887 _YISK(gl)MFLR_
SNRPD2 Ubiquitylation K118 -0.918 -0.587 _NPLIAGK(gl)_
SNRPD3 Ubiquitylation K78 0.797 _FLILPDMLK(gl)NAPMLK_
SNRPD3 Ubiquitylation K84 -0.440 0.082 _NAPMLK(gl)SMK_
SNRPF Ubiquitylation K8 -1.763 _(ac)SLPLNPK(gl)PFLNGLTGKPVMVK_
SNRPF Ubiquitylation K17 -1.612 _(ac)SLPLNPKPFLNGLTGK(gl)PVMVK_
SNRPF Ubiquitylation K24 0.208 0.915 _LK(gl)WGMEYK_
SNRPG Ubiquitylation K3 0.152 _(ac)SK(gl)AHPPELKK(gl)_
SNRPG Ubiquitylation K11 -0.955 _AHPPELKK(gl)_
SNRPG Ubiquitylation K20 -0.065 _LSLK(gl)LNGGR_
SNUPN Ubiquitylation K96 -0.423 _LLELQKSK(gl)_
SNUPN Ubiquitylation K186 -0.840 _GSTSAYTK(gl)SGYCVNR_
SNUPN Ubiquitylation K265 -1.033 _TK(gl)LNPFK_
SNUPN Phosphorylation S392 0.472 _GSSHS(ph)PDHPGCLMEN_
TGS1 Phosphorylation S89 0.022 _GIGLDESELDS(ph)EAELMR_
WDR77 Phosphorylation T5 -1.388 -1.435 _MRKET(ph)PPPLVPPAAR_


© Copyright Svejstrup Laboratory 2015