bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
response to organonitrogen compound
(GO:0010243)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
GNAO1 1 1.200 -1.320 0.217 -0.334 -0.374
CCND1 1 -1.820 3.470
HMGCS1 1 -1.450 3.080 -0.209 0.030
NCOR2 1 1.850 -1.050
NCOR2 1 1.850 -1.050 0.037 -1.127
MGST1 0 -0.160 0.420 -0.611
MGST2 0 -0.730 0.630 -0.876 -0.918
APEX1 0 0.630 -0.180 -0.057 -0.077
ALDOC 0 0.860 0.200 -0.960
BIRC2 0 -0.730 0.440
BIRC2 0 -0.730 0.440
CCNG1 0 0.760 -0.640
CDKN1A 0 1.080 -0.750
MAX 0 -0.780 0.530 -0.276 0.290
MAX 0 -0.780 0.530
PSMB2 0 -0.260 0.740 -0.850 1.495 0.073 -0.594 -0.213
CDO1 0 -0.540 0.620
IL1RN 0 -0.390 0.260 -3.729
SIN3A 0 -0.610 0.780 0.378 -0.208 0.304 -0.168 0.410
CDK1 0 -0.370 0.080 -0.202 -0.884 -0.107 -0.097 -0.501
ATP4B 0 0.870 -0.660

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
APEX1 Ubiquitylation K25 -0.227 _GAVAEDGDELRTEPEAKK(gl)_
APEX1 Ubiquitylation K58 -0.215 _TSPSGK(gl)PATLK_
ATP4B Ubiquitylation K8 0.834 -0.818 _AALQEKK(gl)_
BIRC2 Ubiquitylation K15 -0.259 0.307 _(ac)MEDSTILSDWTNSNK(gl)QK_
BIRC2 Ubiquitylation K17 -0.259 0.307 _(ac)MEDSTILSDWTNSNK(gl)QK_
BIRC2 Ubiquitylation K38 -0.069 _SIMEDSTILSDWTNSNKQK(gl)_
BIRC2 Ubiquitylation K102 -1.755 _LGDSPIQK(gl)HK_
BIRC2 Ubiquitylation K233 -0.511 _LSNWEPK(gl)DDAMSEHR_
BIRC2 Ubiquitylation K410 0.878 _DLVK(gl)QTVQSK_
BIRC2 Ubiquitylation K490 0.305 0.534 _ANVINK(gl)QEHDIIK_
BIRC2 Ubiquitylation K497 -1.934 _ANVINKQEHDIIK(gl)QK_
CCND1 Ubiquitylation K33 -0.490 _AMLK(gl)AEETCAPSVSYFK_
CCND1 Ubiquitylation K46 -1.016 -0.036 _AEETCAPSVSYFK(gl)CVQK_
CCND1 Ubiquitylation K95 -0.733 -0.137 _FLSLEPVK(gl)K_
CCND1 Ubiquitylation K96 -0.846 -0.155 _FLSLEPVKK(gl)_
CCND1 Ubiquitylation K238 0.245 _VIK(gl)CDPDCLR_
CCNG1 Ubiquitylation K187 0.399 _LEAQLK(gl)ACHCR_
CDK1 Ubiquitylation K6 0.011 -0.784 _(ac)M(ox)EDYTK(gl)IEK_
CDK1 Ubiquitylation K20 -0.327 -0.270 _IGEGTYGVVYK(gl)GR_
CDK1 Ubiquitylation K33 0.736 0.239 _TTGQVVAMK(gl)K_
CDK1 Ubiquitylation K34 -0.306 _TTGQVVAMKK(gl)_
CDK1 Ubiquitylation K58 0.312 -0.262 _EISLLK(gl)ELR_
CDK1 Ubiquitylation K136 -0.468 _DLK(gl)PQNLLIDDK(gl)GTIK_
CDK1 Ubiquitylation K145 0.161 -0.954 _DLKPQNLLIDDK(gl)GTIK_
CDK1 Ubiquitylation K149 -0.038 _GTIK(gl)LADFGLAR_
CDK1 Ubiquitylation K251 -0.047 -1.236 _WK(gl)PGSLASHVK_
CDK1 Ubiquitylation K280 0.179 -1.210 _MLIYDPAK(gl)R_
CDKN1A Ubiquitylation K188 -2.505 -1.077 _QTSMTDFYHSK(gl)R_
CDO1 Ubiquitylation K8 -2.513 -0.979 _(ac)MEQTEVLK(gl)PR_
GNAO1 Ubiquitylation K29 0.529 -0.094 _NLREDGEK(gl)AAK_
GNAO1 Ubiquitylation K92 1.569 _LK(gl)IDFGEAAR_
GNAO1 Ubiquitylation K349 -0.221 -0.339 _NNLK(gl)ECGLY_
HMGCS1 Phosphorylation S4 -1.161 -1.052 _PGS(ph)LPLNAEACWPK_
HMGCS1 Ubiquitylation K100 -0.673 _LEVGTETIIDK(gl)SK_
HMGCS1 Ubiquitylation K102 -1.761 -0.427 _LEVGTETIIDKSK(gl)_
HMGCS1 Ubiquitylation K273 -0.550 -0.790 _LVQK(gl)SLAR_
HMGCS1 Ubiquitylation K321 -0.588 -0.833 _AFMK(gl)ASSELFSQK_
HMGCS1 Ubiquitylation K330 -0.934 _ASSELFSQK(gl)TK_
HMGCS1 Ubiquitylation K332 -0.326 _ASSELFSQKTK(gl)_
HMGCS1 Ubiquitylation K409 -0.898 _ITASLCDLK(gl)SR_
HMGCS1 Ubiquitylation K428 -1.720 _TGVAPDVFAENMK(gl)LR_
HMGCS1 Phosphorylation S495 -1.763 -1.842 _RPTPNDDTLDEGVGLVHSNIATEHIPS(ph)PAKK_
MAX Phosphorylation S2 0.341 -0.060 _(ac)S(ph)DNDDIEVES(ph)DEEQPR_
MAX Phosphorylation S2 0.510 0.568 _(ac)S(ph)DNDDIEVESDADKR_
MAX Phosphorylation S11 0.341 -0.060 _(ac)S(ph)DNDDIEVES(ph)DEEQPR_
MAX Phosphorylation S11 -0.408 0.069 _(ac)S(ph)DNDDIEVES(ph)DADKR_
MAX Ubiquitylation K57 -0.903 0.246 _DSVPSLQGEK(gl)ASR_
MGST2 Ubiquitylation K34 -0.986 _YK(gl)VTPPAVTGSPEFER_
NCOR2 Phosphorylation S939 -0.637 _LLS(ph)PRPSLLTPTGDPR_
NCOR2 Phosphorylation S943 -0.740 _LLSPRPS(ph)LLTPTGDPR_
NCOR2 Phosphorylation S956 -0.223 -0.308 _ANAS(ph)PQKPLDLK_
NCOR2 Phosphorylation S1023 -0.334 _S(ph)RSPAPPADKEAFAAEAQK_
NCOR2 Phosphorylation S1025 1.950 _SRS(ph)PAPPADKEAFAAEAQK_
NCOR2 Phosphorylation T1383 -1.746 -2.157 _EGT(ph)PPPPPPSR_
NCOR2 Phosphorylation S1479 0.325 -0.132 _SLIGS(ph)PGR_
NCOR2 Phosphorylation S1778 -0.687 _HSSSPLS(ph)PGGPTHLTKPTTTSSSER_
NCOR2 Phosphorylation S1970 -0.321 _SGLEPAS(ph)SPSK_
NCOR2 Phosphorylation S1971 -0.480 _SGLEPASS(ph)PSK_
NCOR2 Phosphorylation S2223 -0.074 -1.140 _TSVLGGGEDGIEPVS(ph)PPEGMTEPGHSR_
NCOR2 Phosphorylation S2258 -0.573 -0.210 _S(ph)PGNTSQPPAFFSK_
NCOR2 Phosphorylation S2413 0.973 _AKS(ph)PAPGLASGDRPPSVSSVHSEGDCNR_
PSMB2 Ubiquitylation K29 -0.187 -0.755 _VAASNIVQMK(gl)DDHDK_
PSMB2 Ubiquitylation K68 -0.570 -1.047 _NVQLYK(gl)M(ox)R_
PSMB2 Ubiquitylation K162 -0.258 -0.501 _K(gl)CLEELQK(gl)R_
PSMB2 Ubiquitylation K169 -0.265 -0.366 _KCLEELQK(gl)R_
PSMB2 Ubiquitylation K185 -1.010 -1.358 _IIDK(gl)NGIHDLDNISFPK(gl)QGS_
PSMB2 Ubiquitylation K198 -1.268 -1.381 _IIDK(gl)NGIHDLDNISFPK(gl)QGS_
SIN3A Ubiquitylation K155 0.182 _EFK(gl)SQSIDTPGVISR_
SIN3A Phosphorylation T266 -0.572 _VSKPSQLQAHTPASQQT(ph)PPLPPYASPR_
SIN3A Phosphorylation S277 -1.598 _S(ph)PPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNK_
SIN3A Phosphorylation S295 -1.959 _SPPVQPHTPVTISLGTAPS(ph)LQNNQPVEFNHAINYVNK_
SIN3A Ubiquitylation K638 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K639 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K715 1.012 _GFNK(gl)VWR_
SIN3A Phosphorylation S832 0.764 0.363 _GDLS(ph)DVEEEEEEEM(ox)DVDEATGAVKK_
SIN3A Ubiquitylation K875 0.131 0.003 _LLFSNTAAQK(gl)LR_
SIN3A Ubiquitylation K937 -0.224 -0.025 _DK(gl)SDSPAIQLR_
SIN3A Phosphorylation S940 -0.107 _DKSDS(ph)PAIQLR_
SIN3A Phosphorylation T1111 0.691 0.517 _YM(ox)NSDTT(ph)SPELR_
SIN3A Phosphorylation S1112 0.623 0.725 _YM(ox)NSDTTS(ph)PELR_


© Copyright Svejstrup Laboratory 2015