bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
spliceosomal complex assembly
(GO:0000245)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
SCAF11 2 0.150 -0.090 1.759 0.952 1.247 0.376 0.468
PRPF6 1 -1.220 1.930 -0.538 -0.333 0.350 0.139 0.304
SNRPD2 1 -1.740 2.880 0.068 -0.598 0.211 0.010 0.140
TXNL4A 1 -1.870 3.440
USP39 1 -0.890 1.910 0.215 0.205 0.107 -0.550 -0.100
RBM5 0 0.100 0.310 0.425 -0.244 0.309 -0.230 0.299
DDX1 0 -0.100 0.160 -0.034 -0.036 0.487 -0.133 0.258
GEMIN2 0 0.620 -0.610
CRNKL1 0 0.504 0.131 0.065 -0.983 -0.157
PRPF19 0 -0.460 0.190 -0.179 -0.151 -0.246
SRPK2 0 -0.090 0.510 -0.634
SNRPG 0 -0.190 -0.311 0.245 0.156 0.568
SNRPG 0
SNRPD1 0 -0.780 0.750 0.034 -0.359 0.355 -1.109 -0.252
SF1 0 -1.650 2.470 -0.710
SF1 0 -1.650 2.470 -0.461
SF1 0 -1.650 2.470 -0.405 -0.524 -0.618 -1.262 -0.522
ZRSR2 0 0.620 -0.290
SMN1 0 -1.430 1.720 0.023 0.246 -1.731
SMN1 0 -0.560 0.640 0.023 0.246 -1.731
SMN2 0 0.023 0.246 -1.731
SNRPE 0 -1.140 2.270 -0.259 -0.638 -0.181 0.064 -0.174

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
CRNKL1 Ubiquitylation K475 0.099 _GIEDIIVSK(gl)R_
DDX1 Ubiquitylation K82 -0.137 _TTIK(gl)TGASVLNK_
DDX1 Ubiquitylation K117 1.370 _EVK(gl)EWHGCR_
DDX1 Ubiquitylation K173 1.499 _FGFGFGGTGKK(gl)_
DDX1 Ubiquitylation K260 -0.585 _DGFVALSK(gl)APDGYIVK_
DDX1 Ubiquitylation K281 0.294 _SQHSGNAQVTQTK(gl)FLPNAPK_
DDX1 Ubiquitylation K358 1.293 _LDDLVSTGK(gl)LNLSQVR_
DDX1 Phosphorylation S481 0.023 0.050 _DNTRPGANS(ph)PEMWSEAIK_
GEMIN2 Phosphorylation S81 -0.444 _KQS(ph)VNISLSGCQPAPEGYSPTLQWQQQQVAQFSTVR_
PRPF19 Ubiquitylation K122 0.200 _LTK(gl)EVTAAR_
PRPF19 Ubiquitylation K261 -1.023 0.257 _SSEQILATLK(gl)GHTK_
PRPF6 Ubiquitylation K146 -2.280 _IQQQFSDLK(gl)R_
PRPF6 Ubiquitylation K585 0.925 0.567 _AAYFEK(gl)NHGTR_
PRPF6 Ubiquitylation K618 3.222 1.333 _AEVLWLMGAKSK(gl)_
PRPF6 Ubiquitylation K680 0.476 _VFMK(gl)SVK_
PRPF6 Ubiquitylation K737 0.526 _EAYNQGLK(gl)K_
PRPF6 Ubiquitylation K738 -0.238 _EAYNQGLKK(gl)_
RBM5 Phosphorylation S59 0.021 0.472 _YDDYRDYDS(ph)PERER_
RBM5 Phosphorylation S624 0.318 0.387 _GLVAAYSGDS(ph)DNEEELVER_
SCAF11 Ubiquitylation K120 -0.349 _NENSFEK(gl)QVSCHENSK_
SCAF11 Ubiquitylation K146 0.229 _EDLLSAK(gl)VCDLK_
SCAF11 Ubiquitylation K151 -2.294 _VCDLK(gl)WIHR_
SCAF11 Ubiquitylation K165 -0.943 _NSLYSETGGK(gl)K_
SCAF11 Ubiquitylation K166 -0.834 _NSLYSETGGK(gl)K_
SCAF11 Ubiquitylation K171 -1.977 -1.385 _NAAIK(gl)INKPQR_
SCAF11 Ubiquitylation K299 -2.071 _GYALAHTQEGEEKK(gl)_
SCAF11 Phosphorylation S338 -0.660 -0.850 _S(ph)PISDNSGCDAPGNSNPSLSVPSSAESEK_
SCAF11 Phosphorylation S402 0.253 0.097 _SSS(ph)NDSVDEETAESDTSPVLEK_
SCAF11 Phosphorylation S405 0.301 0.301 _SSSNDS(ph)VDEETAESDTSPVLEK_
SCAF11 Phosphorylation S533 4.391 _QDQISGLS(ph)QSEVK_
SCAF11 Phosphorylation T602 0.547 0.450 _T(ph)EELIESPKLESSEGEIIQTVDR_
SCAF11 Phosphorylation S608 0.626 0.504 _TEELIES(ph)PKLESSEGEIIQTVDR_
SCAF11 Phosphorylation S613 0.576 0.654 _TEELIESPKLES(ph)SEGEIIQTVDR_
SCAF11 Phosphorylation S614 0.665 0.542 _LESS(ph)EGEIIQTVDR_
SCAF11 Ubiquitylation K676 -0.703 _NNLLNTK(gl)LEK_
SCAF11 Phosphorylation S796 0.171 _FHS(ph)PSTTWSPNK_
SCAF11 Phosphorylation S802 0.689 _FHS(ph)PSTTWS(ph)PNKDTPQEK_
SCAF11 Phosphorylation S963 -0.389 -0.222 _IDRDSYS(ph)PR_
SCAF11 Phosphorylation S1170 0.345 _NSS(ph)GPQSGWMK_
SF1 Ubiquitylation K78 0.110 _NIEKECNAK(gl)IMIR_
SF1 Phosphorylation S80 -1.127 -1.226 _TGDLGIPPNPEDRS(ph)PS(ph)PEPIYNSEGK_
SF1 Phosphorylation S82 -1.197 -0.218 _SPS(ph)PEPIYNSEGK_
SF1 Ubiquitylation K131 0.313 0.887 _NILK(gl)QGIETPEDQNDLRK_
SF1 Phosphorylation S181 -0.584 _YACGLWGLS(ph)PASR_
SMN1 Phosphorylation S4 0.158 0.444 _(ac)AMS(ph)SGGSGGGVPEQEDSVLFR_
SMN1 Phosphorylation S5 0.453 0.382 _(ac)AMSS(ph)GGSGGGVPEQEDSVLFR_
SMN1 Phosphorylation S8 0.239 0.738 _(ac)AMSSGGS(ph)GGGVPEQEDSVLFR_
SMN1 Phosphorylation T25 1.306 0.581 _GT(ph)GQSDDSDIWDDTALIK_
SMN1 Phosphorylation S28 0.885 0.944 _GTGQS(ph)DDSDIWDDTALIK_
SMN1 Phosphorylation S31 0.980 _RGTGQSDDS(ph)DIWDDTALIK_
SMN1 Ubiquitylation K45 0.101 1.114 _AYDK(gl)AVASFK_
SMN1 Ubiquitylation K51 -0.448 _AVASFK(gl)HALK_
SMN1 Ubiquitylation K65 -0.724 _NGDICETSGK(gl)PK_
SMN1 Ubiquitylation K83 -0.049 -0.330 _K(gl)NTAASLQQWK_
SMN1 Ubiquitylation K93 0.896 _NTAASLQQWK(gl)VGDK_
SMN1 Ubiquitylation K179 -1.678 _SPGNK(gl)SDNIKPK_
SMN1 Ubiquitylation K209 -0.581 -0.285 _LGPGK(gl)PGLK_
SMN2 Phosphorylation S4 0.158 0.444 _(ac)AMS(ph)SGGSGGGVPEQEDSVLFR_
SMN2 Phosphorylation S5 0.453 0.382 _(ac)AMSS(ph)GGSGGGVPEQEDSVLFR_
SMN2 Phosphorylation S8 0.239 0.738 _(ac)AMSSGGS(ph)GGGVPEQEDSVLFR_
SMN2 Phosphorylation T25 1.306 0.581 _GT(ph)GQSDDSDIWDDTALIK_
SMN2 Phosphorylation S28 0.885 0.944 _GTGQS(ph)DDSDIWDDTALIK_
SMN2 Phosphorylation S31 0.980 _RGTGQSDDS(ph)DIWDDTALIK_
SMN2 Ubiquitylation K45 0.101 1.114 _AYDK(gl)AVASFK_
SMN2 Ubiquitylation K51 -0.448 _AVASFK(gl)HALK_
SMN2 Ubiquitylation K65 -0.724 _NGDICETSGK(gl)PK_
SMN2 Ubiquitylation K83 -0.049 -0.330 _K(gl)NTAASLQQWK_
SMN2 Ubiquitylation K93 0.896 _NTAASLQQWK(gl)VGDK_
SMN2 Ubiquitylation K179 -1.678 _SPGNK(gl)SDNIKPK_
SMN2 Ubiquitylation K209 -0.581 -0.285 _LGPGK(gl)PGLK_
SNRPD1 Ubiquitylation K44 0.032 _AVK(gl)MTLK_
SNRPD2 Phosphorylation S2 -0.117 0.507 _(ac)S(ph)LLNKPK_
SNRPD2 Ubiquitylation K6 -0.352 _(ac)SLLNK(gl)PK_
SNRPD2 Ubiquitylation K8 -0.201 -0.603 _(ac)SLLNKPK(gl)SEMTPEELQK_
SNRPD2 Phosphorylation T12 0.766 _SEMT(ph)PEELQKR_
SNRPD2 Ubiquitylation K98 0.883 0.887 _YISK(gl)MFLR_
SNRPD2 Ubiquitylation K118 -0.918 -0.587 _NPLIAGK(gl)_
SNRPG Ubiquitylation K3 0.152 _(ac)SK(gl)AHPPELKK(gl)_
SNRPG Ubiquitylation K11 -0.955 _AHPPELKK(gl)_
SNRPG Ubiquitylation K20 -0.065 _LSLK(gl)LNGGR_
SRPK2 Phosphorylation S483 -1.638 _IPESQFPEFSTSLFSGSLEPVACGSVLSEGSPLTEQEES(ph)SPSHDR_
SRPK2 Phosphorylation S496 0.096 _TVSAS(ph)STGDLPK_
SRPK2 Phosphorylation S497 -0.015 -0.154 _TVSASS(ph)TGDLPK_
SRPK2 Ubiquitylation K618 0.453 _HFALSGK(gl)YSR_
TXNL4A Ubiquitylation K139 0.359 -0.277 _DYSTK(gl)YRY_
USP39 Phosphorylation S43 -0.046 1.159 _EPEAASS(ph)RGSPVR_
USP39 Phosphorylation S46 1.807 0.030 _EPEAASSRGS(ph)PVR_
USP39 Phosphorylation S82 0.415 0.295 _EVDEDS(ph)EPEREVR_
ZRSR2 Phosphorylation S349 -0.162 0.086 _DIYLS(ph)PDR_
ZRSR2 Phosphorylation S384 0.014 _RNPS(ph)PDHSYK_


© Copyright Svejstrup Laboratory 2015