bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
PID_RET_PATHWAY
(Pathway_643)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
JUN 3 -0.930 0.930 -0.126
RHOA 0 -0.510 1.370 -0.485 0.532 0.279
PRKACA 0 0.380 -0.680 -1.005 -0.697 0.234 0.487
PXN 0 1.020 -0.760
MAPK3 0
GRB10 0 0.900 -0.860
GAB1 0 1.950 -1.110
SOS1 0 0.500 -0.620 -0.570
CREB1 0 1.080 -0.800 -1.027
PIK3CA 0
RAC1 0 -0.580 1.580 0.486 -0.364 -0.568
PIK3R1 0 1.910 -1.220 -0.441 0.147
PRKCA 0 0.750 -0.690 0.349 0.585
PRKCA 0 0.750 -0.690
NCK1 0 -0.370 0.580
CRK 0 -0.790 0.230
IRS1 0
HRAS 0 1.470 -0.520
GRB2 0 -0.240 0.300 -1.021 0.057 0.906
PTPN11 0 -0.210 -0.400 0.644 1.053 0.451
IRS2 0 -0.190 -0.130
PDLIM7 0 0.490 -0.430 -0.704 -0.559 -0.337
SRC 0 0.050 0.470 -0.031

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
CREB1 Phosphorylation S271 -0.979 -1.450 _TAPTSTIAPGVVM(ox)ASS(ph)PALPTQPAEEAAR_
CREB1 Ubiquitylation K333 1.343 _ALK(gl)DLYCHK_
CRK Phosphorylation S40 0.533 0.363 _DS(ph)STSPGDYVLSVSENSR_
CRK Phosphorylation S41 1.065 0.801 _DSS(ph)TSPGDYVLSVSENSR_
GAB1 Phosphorylation S266 0.756 0.551 _SYS(ph)HDVLPK_
GAB1 Phosphorylation S367 0.230 0.176 _TAS(ph)DTDSSYCIPTAGMS(ph)PSR_
GAB1 Phosphorylation T369 -0.352 _TASDT(ph)DSSYCIPTAGMS(ph)PSR_
GAB1 Phosphorylation S381 -0.481 0.139 _TASDTDSSYCIPTAGM(ox)S(ph)PSR_
GAB1 Phosphorylation S401 0.266 0.788 _DAS(ph)SQDCYDIPR_
GAB1 Phosphorylation S402 0.328 0.633 _DASS(ph)QDCYDIPR_
GAB1 Phosphorylation S419 0.540 _SSS(ph)LEGFHNHFK_
GRB10 Phosphorylation S104 -0.985 -0.688 _SIQPQVS(ph)PR_
GRB2 Ubiquitylation K10 0.146 _YDFK(gl)ATADDELSFK_
GRB2 Ubiquitylation K20 -0.078 _ATADDELSFK(gl)R_
GRB2 Ubiquitylation K69 -0.362 0.641 _AK(gl)AEEMLSK_
GRB2 Ubiquitylation K76 0.754 _AEEMLSK(gl)QR_
GRB2 Ubiquitylation K109 0.381 -0.002 _FGNDVQHFK(gl)VLR_
HRAS Ubiquitylation K170 -1.005 _K(gl)LNPPDESGPGCMSCK_
IRS1 Phosphorylation S1101 -0.078 _HSS(ph)ETFSSTPSATR_
IRS2 Phosphorylation S308 -0.079 -0.510 _SKS(ph)QSSGSSATHPISVPGAR_
IRS2 Phosphorylation T365 0.641 0.852 _T(ph)ASEGDGGAAAGAAAAGAR_
IRS2 Phosphorylation S367 0.757 0.612 _TAS(ph)EGDGGAAAGAAAAGAR_
IRS2 Phosphorylation S393 -1.580 -1.221 _PVSVAGSPLS(ph)PGPVR_
IRS2 Phosphorylation S520 0.359 -1.006 _S(ph)NTPESIAETPPAR_
IRS2 Phosphorylation T522 -1.103 -0.770 _SNT(ph)PESIAETPPAR_
IRS2 Phosphorylation T529 0.230 0.164 _S(ph)NTPESIAET(ph)PPAR_
IRS2 Phosphorylation S562 -0.026 0.439 _RVS(ph)GDAAQDLDR_
IRS2 Phosphorylation S579 0.542 0.362 _RTYS(ph)LTTPAR_
IRS2 Phosphorylation S621 -0.190 _LCPSCPAS(ph)SPK_
IRS2 Phosphorylation S622 -0.195 _LCPSCPASS(ph)PK_
IRS2 Phosphorylation S681 0.409 _SDDYM(ox)PM(ox)S(ph)PASVSAPK_
IRS2 Phosphorylation S732 -1.089 _AS(ph)SPAESSPEDSGYM(ox)R_
IRS2 Phosphorylation S733 -1.027 0.522 _ASS(ph)PAESSPEDSGYM(ox)R_
IRS2 Phosphorylation S738 0.522 _ASS(ph)PAESS(ph)PEDSGYMR_
IRS2 Phosphorylation S917 -0.592 -1.025 _S(ph)PGEYINIDFGEPGAR_
IRS2 Phosphorylation S1164 -0.499 _HSSETFSSTTTVTPVS(ph)PSFAHNPK_
IRS2 Phosphorylation S1178 0.766 0.277 _HNSAS(ph)VENVSLR_
IRS2 Phosphorylation T1204 -0.454 _SSEGGVGVGPGGGDEPPT(ph)SPR_
IRS2 Phosphorylation S1205 -0.291 _SSEGGVGVGPGGGDEPPTS(ph)PR_
JUN Phosphorylation S58 -0.167 -1.247 _AKNS(ph)DLLTSPDVGLLK_
JUN Phosphorylation T62 2.545 1.674 _NSDLLT(ph)SPDVGLLK_
JUN Phosphorylation S63 2.030 1.458 _NSDLLTS(ph)PDVGLLK_
JUN Ubiquitylation K70 9.213 _NSDLLTSPDVGLLK(gl)_
JUN Phosphorylation S73 1.499 0.845 _LAS(ph)PELER_
JUN Phosphorylation S243 -0.642 -1.399 _LQALKEEPQTVPEMPGETPPLS(ph)PIDMESQER_
JUN Ubiquitylation K309 1.034 0.155 _EQVAQLK(gl)QK_
MAPK3 Phosphorylation Y204 -0.807 -2.487 _IADPEHDHTGFLTEY(ph)VATR_
MAPK3 Ubiquitylation K289 -0.608 _NYLQSLPSKTK(gl)_
NCK1 Phosphorylation S85 -0.027 -0.877 _RKPS(ph)VPDSASPADDSFVDPGER_
NCK1 Phosphorylation S91 0.493 _RKPSVPDSAS(ph)PADDSFVDPGER_
PDLIM7 Phosphorylation S111 -0.573 _YTFAPSVS(ph)LNK_
PIK3CA Ubiquitylation K864 0.390 0.588 _NSHTIM(ox)QIQCK(gl)GGLK_
PIK3CA Ubiquitylation K868 0.204 0.651 _NSHTIM(ox)QIQCKGGLK(gl)_
PIK3CA Ubiquitylation K974 -0.273 _GAQECTK(gl)TREFER_
PRKACA Ubiquitylation K30 -0.143 _AKEDFLKK(gl)_
PRKACA Ubiquitylation K93 0.839 0.714 _QIEHTLNEK(gl)R_
PRKCA Phosphorylation S10 -0.650 0.036 _(ac)ADVFPGNDS(ph)TASQDVANR_
PRKCA Phosphorylation S13 -1.038 0.335 _(ac)ADVFPGNDSTAS(ph)QDVANR_
PRKCA Phosphorylation S226 0.693 0.415 _STLNPQWNES(ph)FTFK_
PRKCA Ubiquitylation K316 -0.522 -0.535 _LGPAGNK(gl)VISPSEDR_
PTPN11 Ubiquitylation K124 0.562 _EAEK(gl)LLTEK_
PXN Phosphorylation S85 -0.156 0.192 _FIHQQPQSSS(ph)PVYGSSAK_
PXN Phosphorylation T136 1.322 _SAEPSPTVMST(ph)SLGSNLSELDR_
PXN Phosphorylation S140 -0.291 -0.948 _SAEPSPTVM(ox)STSLGS(ph)NLSELDR_
PXN Phosphorylation S302 -0.167 _S(ph)SPGGQDEGGFMAQGK_
PXN Phosphorylation S303 -0.167 _S(ph)SPGGQDEGGFMAQGK_
PXN Phosphorylation S322 -1.234 _TGSSS(ph)PPGGPPKPGSQLDSMLGSLQSDLNK_
RAC1 Ubiquitylation K115 -1.745 -0.215 _AK(gl)WYPEVR_
RAC1 Ubiquitylation K142 0.492 _LDLRDDK(gl)DTIEK_
RAC1 Ubiquitylation K152 0.099 -0.292 _K(gl)LTPITYPQGLAMAK_
RAC1 Ubiquitylation K166 -0.981 -0.655 _LTPITYPQGLAMAK(gl)EIGAVK_
RAC1 Ubiquitylation K172 1.026 0.412 _EIGAVK(gl)YLECSALTQR_
RAC1 Ubiquitylation K185 -0.113 0.578 _GLK(gl)TVFDEAIR_
RAC1 Ubiquitylation K202 -1.379 -1.447 _AVLCPPPVK(gl)KR_
RAC1 Ubiquitylation K203 -1.708 -1.447 _AVLCPPPVKK(gl)_
RHOA Ubiquitylation K6 0.708 _K(gl)KLVIVGDGACGK_
RHOA Ubiquitylation K7 0.708 _K(gl)KLVIVGDGACGK_
RHOA Ubiquitylation K118 -0.408 _HFCPNVPIILVGNK(gl)K_
RHOA Ubiquitylation K119 -0.408 _HFCPNVPIILVGNK(gl)K_
RHOA Ubiquitylation K135 -0.528 -0.796 _MK(gl)QEPVKPEEGRDMANR_
RHOA Ubiquitylation K162 0.345 0.453 _IGAFGYMECSAK(gl)TK_
SOS1 Phosphorylation S1082 0.278 _IPESETESTASAPNS(ph)PR_
SOS1 Phosphorylation S1166 0.097 -0.094 _RPESAPAES(ph)SPSK_
SRC Phosphorylation S17 -0.604 -0.689 _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_
SRC Phosphorylation S75 0.060 0.331 _LFGGFNSSDTVTS(ph)PQR_


© Copyright Svejstrup Laboratory 2015