bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
BIOCARTA_ECM_PATHWAY
(Pathway_536)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
FYN 1 1.080 -1.100
FYN 1 1.080 -1.100
PFN1 1 -0.430 -0.180 0.002 2.497 -0.084 0.348 -0.059
RAF1 1 2.020 -1.230
TLN1 1 -0.130 0.000 0.807 0.246 0.137
MAP2K1 1 -1.590 2.780
MYLK 0 -0.520 0.000 0.754
RHOA 0 -0.510 1.370 -0.485 0.532 0.279
ROCK1 0 -1.420 2.380 -0.112 -0.732
PXN 0 1.020 -0.760
ARHGAP5 0 -0.150 0.300
MAPK3 0
PIK3CA 0
DIAPH1 0 0.480 -0.910 -0.053 -0.130 0.367
PIK3R1 0 1.910 -1.220 -0.441 0.147
GSN 0 0.350 -0.590
ITGB1 0 0.390 -0.650 0.101 -0.036
HRAS 0 1.470 -0.520
SRC 0 0.050 0.470 -0.031
ITGA1 0 -0.750 1.480 0.650 0.069

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
ARHGAP5 Phosphorylation S765 1.073 _HNLDVVS(ph)PIPANK_
ARHGAP5 Phosphorylation T1217 0.497 0.807 _GGIDNPAIT(ph)SDQELDDKK_
ARHGAP5 Phosphorylation S1218 0.377 0.527 _GGIDNPAITS(ph)DQELDDKK_
DIAPH1 Phosphorylation S22 0.053 0.108 _S(ph)PDELPSAGGDGGK_
DIAPH1 Ubiquitylation K503 0.696 0.481 _HELQVEMK(gl)K_
DIAPH1 Ubiquitylation K504 0.243 0.685 _HELQVEM(ox)KK(gl)_
FYN Ubiquitylation K13 0.286 _DKEATK(gl)LTEER_
FYN Phosphorylation S21 0.373 0.731 _DGS(ph)LNQSSGYR_
FYN Ubiquitylation K259 0.921 _LTDLSVK(gl)TK_
FYN Ubiquitylation K261 0.099 _LTDLSVKTK(gl)_
FYN Ubiquitylation K273 6.025 _SLCLEKK(gl)_
FYN Ubiquitylation K275 -0.521 _ESLQLIK(gl)R_
GSN Ubiquitylation K360 -0.879 0.993 _AALK(gl)TASDFITK_
HRAS Ubiquitylation K170 -1.005 _K(gl)LNPPDESGPGCMSCK_
ITGB1 Ubiquitylation K774 0.402 _MNAK(gl)WDTGENPIYK_
ITGB1 Ubiquitylation K784 -0.172 0.350 _WDTGENPIYK(gl)SAVTTVVNPK_
ITGB1 Ubiquitylation K794 0.755 0.604 _SAVTTVVNPK(gl)YEGK_
MAP2K1 Ubiquitylation K192 -0.205 -0.241 _DVK(gl)PSNILVNSR_
MAP2K1 Phosphorylation S385 0.066 _RSDAEEVDFAGWLCSTIGLNQPS(ph)TPTHAAGV_
MAP2K1 Phosphorylation T386 0.377 _RSDAEEVDFAGWLCSTIGLNQPST(ph)PTHAAGV_
MAPK3 Phosphorylation Y204 -0.807 -2.487 _IADPEHDHTGFLTEY(ph)VATR_
MAPK3 Ubiquitylation K289 -0.608 _NYLQSLPSKTK(gl)_
PFN1 Ubiquitylation K54 -0.190 0.319 _TFVNITPAEVGVLVGK(gl)DR_
PFN1 Ubiquitylation K70 0.186 0.451 _SSFYVNGLTLGGQK(gl)CSVIR_
PFN1 Ubiquitylation K91 -0.513 -0.205 _TK(gl)STGGAPTFNVTVTK_
PFN1 Ubiquitylation K105 0.309 -0.352 _STGGAPTFNVTVTK(gl)TDK_
PFN1 Ubiquitylation K108 0.414 -0.098 _TDK(gl)TLVLLMGK_
PFN1 Ubiquitylation K126 0.640 0.539 _EGVHGGLINK(gl)K_
PFN1 Ubiquitylation K127 0.582 0.353 _EGVHGGLINKK(gl)_
PIK3CA Ubiquitylation K864 0.390 0.588 _NSHTIM(ox)QIQCK(gl)GGLK_
PIK3CA Ubiquitylation K868 0.204 0.651 _NSHTIM(ox)QIQCKGGLK(gl)_
PIK3CA Ubiquitylation K974 -0.273 _GAQECTK(gl)TREFER_
PXN Phosphorylation S85 -0.156 0.192 _FIHQQPQSSS(ph)PVYGSSAK_
PXN Phosphorylation T136 1.322 _SAEPSPTVMST(ph)SLGSNLSELDR_
PXN Phosphorylation S140 -0.291 -0.948 _SAEPSPTVM(ox)STSLGS(ph)NLSELDR_
PXN Phosphorylation S302 -0.167 _S(ph)SPGGQDEGGFMAQGK_
PXN Phosphorylation S303 -0.167 _S(ph)SPGGQDEGGFMAQGK_
PXN Phosphorylation S322 -1.234 _TGSSS(ph)PPGGPPKPGSQLDSMLGSLQSDLNK_
RAF1 Phosphorylation S29 0.028 -0.571 _DAVFDGSSCIS(ph)PTIVQQFGYQR_
RAF1 Phosphorylation T31 0.028 -0.669 _DAVFDGSSCIS(ph)PTIVQQFGYQR_
RAF1 Phosphorylation S244 0.053 _YSTPHAFTFNTSS(ph)PSSEGSLSQR_
RAF1 Phosphorylation S259 -0.069 0.054 _STS(ph)TPNVHM(ox)VSTTLPVDSR_
RAF1 Phosphorylation S301 -0.651 _SHSESASPSALSSSPNNLS(ph)PTGWSQPK_
RAF1 Phosphorylation T303 -0.664 _SHSESASPSALSSSPNNLSPT(ph)GWSQPK_
RAF1 Phosphorylation S497 -0.449 _SRWS(ph)GSQQVEQPTGSVLWMAPEVIR_
RAF1 Phosphorylation S621 0.212 0.271 _SAS(ph)EPSLHR_
RAF1 Phosphorylation S642 -0.197 0.463 _AAHTEDINACTLTTS(ph)PR_
RHOA Ubiquitylation K6 0.708 _K(gl)KLVIVGDGACGK_
RHOA Ubiquitylation K7 0.708 _K(gl)KLVIVGDGACGK_
RHOA Ubiquitylation K118 -0.408 _HFCPNVPIILVGNK(gl)K_
RHOA Ubiquitylation K119 -0.408 _HFCPNVPIILVGNK(gl)K_
RHOA Ubiquitylation K135 -0.528 -0.796 _MK(gl)QEPVKPEEGRDMANR_
RHOA Ubiquitylation K162 0.345 0.453 _IGAFGYMECSAK(gl)TK_
ROCK1 Phosphorylation S1105 -0.245 -0.845 _LLDLSDSTSVAS(ph)FPSADETDGNLPESR_
SRC Phosphorylation S17 -0.604 -0.689 _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_
SRC Phosphorylation S75 0.060 0.331 _LFGGFNSSDTVTS(ph)PQR_
TLN1 Ubiquitylation K334 -0.489 0.561 _LLGITK(gl)ECVM(ox)R_
TLN1 Phosphorylation S423 0.105 _DHFGLEGDEESTMLEDS(ph)VSPKK_
TLN1 Phosphorylation S425 -0.366 -0.322 _DHFGLEGDEESTMLEDSVS(ph)PKK_
TLN1 Ubiquitylation K869 -0.260 _ILADATAK(gl)MVEAAK_
TLN1 Ubiquitylation K1541 0.365 2.311 _EVANSTANLVK(gl)TIK_
TLN1 Ubiquitylation K2021 0.309 0.479 _EGILK(gl)TAK_


© Copyright Svejstrup Laboratory 2015