bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Category

Results for the Category
phosphatase binding
(GO:0019902)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

 Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
DLG3 2 0.180 -1.120 1.552 0.102 0.488
DLG3 2 0.180 -1.120
SH2D4A 2 -0.130 0.140
WNK1 1 -2.390 5.600 0.546 0.639
WNK1 1 -0.180 0.010 0.546 0.639
DLG1 1 0.400 -0.220 1.552 0.102 0.488
TSC2 1 0.810 -0.710
TSC2 1 0.810 -0.710 -0.715
CHCHD3 1 -0.340 0.430 0.065 0.055
CHCHD3 1 -0.340 0.430
SH3GL1 1 0.960 -1.010
WNK2 0 -0.660 0.130 0.546 0.639
WNK3 0 -0.110 -0.490 0.546 0.639
MAST2 0 -0.170 0.680
TRPC4AP 0 0.370 -0.080
CEP192 0 0.280 -0.720
MAPK3 0
PPP1R37 0
ELL 0 0.700 0.150 -0.733
SLC9A3R1 0 0.240 -0.810
CSRNP2 0 -0.760 0.460
SBF2 0 -1.170 2.060
CARHSP1 0 -0.530 -0.090
PPP1R35 0 -0.360 0.540
SMAD3 0 -1.560 1.800
SMAD3 0 0.270 -0.340
SMAD2 0
TPRN 0 -0.440 0.770
SFI1 0 -0.700 0.830
DZIP3 0 0.260 -0.800

PTM Sites:

 Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
CARHSP1 Phosphorylation T23 -1.239 -2.277 _(ac)SSEPPPPPQPPTHQASVGLLDT(ph)PR_
CARHSP1 Phosphorylation S26 -1.033 -1.560 _(ac)SSEPPPPPQPPTHQASVGLLDTPRS(ph)R_
CARHSP1 Phosphorylation S30 0.050 0.327 _ERS(ph)PSPLR_
CARHSP1 Phosphorylation S41 -0.388 -0.186 _GNVVPS(ph)PLPTR_
CARHSP1 Phosphorylation T45 -0.361 -0.197 _GNVVPSPLPT(ph)RR_
CARHSP1 Phosphorylation S52 0.962 1.077 _TFS(ph)ATVR_
CARHSP1 Ubiquitylation K64 -0.088 0.450 _ASQGPVYK(gl)GVCK_
CEP192 Phosphorylation S1755 -0.561 -0.297 _GEVISSGSKPLS(ph)PGPCLDIPSILSNK_
CEP192 Ubiquitylation K2078 -0.840 _EFLQPSSK(gl)ASLESTSDLGASGK_
CHCHD3 Phosphorylation S46 1.606 _S(ph)QRYSGAYGASVSDEELKR_
CHCHD3 Phosphorylation S50 0.558 0.865 _YS(ph)GAYGASVSDEELK_
CHCHD3 Ubiquitylation K170 -0.125 0.892 _VTTEQYQK(gl)AAEEVEAK_
CSRNP2 Phosphorylation Y269 -3.040 _THY(ph)LHTIM(ox)KLELES(ph)K_
CSRNP2 Phosphorylation S280 -3.040 _THY(ph)LHTIM(ox)KLELES(ph)K_
DLG1 Phosphorylation S102 -1.455 _SKPSEPIQPVNTWEISSLPSSTVTSETLPSSLS(ph)PSVEK_
DLG1 Phosphorylation T115 -0.707 -1.378 _YQDEDT(ph)PPQEHISPQITNEVIGPELVHVSEK_
DLG1 Phosphorylation S122 -1.073 _YQDEDTPPQEHIS(ph)PQITNEVIGPELVHVSEK_
DLG1 Phosphorylation S158 0.773 _NLSEIENVHGFVSHSHIS(ph)PIK_
DLG1 Ubiquitylation K321 1.264 1.435 _IMEIK(gl)LIK_
DLG1 Ubiquitylation K361 0.180 _IIEGGAAHK(gl)DGK_
DLG1 Ubiquitylation K452 -0.704 _YSPVSK(gl)AVLGDDEITREPR_
DLG1 Ubiquitylation K556 0.105 _FEAK(gl)IHDLR_
DLG1 Phosphorylation S573 0.697 _EQM(ox)M(ox)NSSISSGS(ph)GSLR_
DLG1 Phosphorylation S575 0.255 0.729 _EQMMNSSISSGSGS(ph)LR_
DLG1 Ubiquitylation K843 1.259 _SMENIMEMNK(gl)R_
DLG3 Phosphorylation S102 -1.455 _SKPSEPIQPVNTWEISSLPSSTVTSETLPSSLS(ph)PSVEK_
DLG3 Phosphorylation T115 -0.707 -1.378 _YQDEDT(ph)PPQEHISPQITNEVIGPELVHVSEK_
DLG3 Phosphorylation S122 -1.073 _YQDEDTPPQEHIS(ph)PQITNEVIGPELVHVSEK_
DLG3 Phosphorylation S158 0.773 _NLSEIENVHGFVSHSHIS(ph)PIK_
DLG3 Ubiquitylation K321 1.264 1.435 _IMEIK(gl)LIK_
DLG3 Ubiquitylation K361 0.180 _IIEGGAAHK(gl)DGK_
DLG3 Ubiquitylation K368 1.043 1.755 _IIEGGAAQK(gl)DGR_
DLG3 Ubiquitylation K452 -0.704 _YSPVSK(gl)AVLGDDEITREPR_
DLG3 Ubiquitylation K556 0.105 _FEAK(gl)IHDLR_
DLG3 Phosphorylation S573 0.697 _EQM(ox)M(ox)NSSISSGS(ph)GSLR_
DLG3 Phosphorylation S575 0.255 0.729 _EQMMNSSISSGSGS(ph)LR_
DLG3 Ubiquitylation K843 1.259 _SMENIMEMNK(gl)R_
DZIP3 Ubiquitylation K830 0.518 _EQLSMK(gl)R_
DZIP3 Ubiquitylation K1042 -1.173 _LK(gl)TAFPQQTR_
ELL Phosphorylation S308 -0.101 -0.337 _LCQPQSTGSLLGDPAAS(ph)SPPGER_
ELL Phosphorylation S309 -0.151 -0.339 _LCQPQSTGSLLGDPAASS(ph)PPGER_
ELL Phosphorylation S437 -0.591 -0.813 _LGLPLLTDCAQPS(ph)RPHGSPSR_
ELL Phosphorylation S442 -0.565 -0.678 _LGLPLLTDCAQPSRPHGS(ph)PSR_
MAPK3 Phosphorylation Y204 -0.807 -2.487 _IADPEHDHTGFLTEY(ph)VATR_
MAPK3 Ubiquitylation K289 -0.608 _NYLQSLPSKTK(gl)_
MAST2 Phosphorylation S66 -0.592 _EQDVVTGVS(ph)PLLFR_
MAST2 Phosphorylation S74 0.187 0.488 _KLS(ph)NPDIFSSTGK_
MAST2 Phosphorylation S148 0.211 0.337 _NQSLGQS(ph)APSLTAGLK_
MAST2 Phosphorylation S876 0.406 0.431 _SLS(ph)EEKEDHSDGLAGLK_
MAST2 Phosphorylation S900 -0.032 _SWVIGS(ph)PEILR_
MAST2 Phosphorylation S931 -0.002 0.339 _RCS(ph)GLLDAPR_
MAST2 Phosphorylation S1256 0.099 -0.774 _SLS(ph)SGESGPGSPTHSHSLSPR_
MAST2 Phosphorylation S1381 -0.056 -0.059 _LHLS(ph)PPLGR_
PPP1R35 Phosphorylation S45 -2.082 _APVPEPGLDLS(ph)LSPRPDSPQPR_
PPP1R35 Phosphorylation S52 -2.170 -1.971 _APVPEPGLDLSLSPRPDS(ph)PQPR_
PPP1R35 Phosphorylation S87 -0.759 -1.109 _LTPPS(ph)PVR_
PPP1R37 Phosphorylation S560 -0.041 _ISVS(ph)SPGR_
PPP1R37 Phosphorylation S561 0.232 -0.720 _ISVSS(ph)PGR_
SFI1 Phosphorylation S1142 -0.357 _AGPGLS(ph)TAGSLDLEAELEEIQQQLLHYQTTK_
SH2D4A Phosphorylation S315 1.655 1.510 _TLS(ph)SSAQEDIIR_
SH3GL1 Ubiquitylation K7 -0.268 _(ac)SVAGLK(gl)K_
SH3GL1 Ubiquitylation K8 -0.654 _(ac)SVAGLKK(gl)_
SH3GL1 Ubiquitylation K76 -0.032 1.606 _LTMLNTVSK(gl)IR_
SH3GL1 Ubiquitylation K177 -0.477 0.450 _QGK(gl)IPDEELR_
SH3GL1 Phosphorylation S287 -0.011 0.143 _IAASS(ph)SFR_
SH3GL1 Phosphorylation S288 0.348 -0.194 _IAASSS(ph)FR_
SLC9A3R1 Ubiquitylation K50 -1.732 _LVEPGSPAEK(gl)AGLLAGDR_
SLC9A3R1 Ubiquitylation K101 -2.049 _LLVVDPETDEQLQK(gl)LGVQVR_
SLC9A3R1 Phosphorylation S280 -0.611 -0.277 _EALAEAALES(ph)PRPALVR_
SLC9A3R1 Phosphorylation S290 -0.404 -0.401 _SAS(ph)SDTSEELNSQDSPPK_
SMAD2 Phosphorylation T8 -0.896 -0.885 _(ac)SSILPFT(ph)PPVVK_
SMAD2 Ubiquitylation K13 -0.058 _(ac)SSILPFTPPVVK(gl)R_
SMAD3 Ubiquitylation K13 -0.704 _(ac)SSILPFTPPIVK(gl)R_
TPRN Phosphorylation S362 -0.033 -1.062 _GDLGPAS(ph)PSQELGSQPVPGGDGAPALGK_
TPRN Phosphorylation S417 -1.149 _WQRPS(ph)SPPPFLPAASEEAEPAEGLR_
TPRN Phosphorylation S418 -1.317 _WQRPSS(ph)PPPFLPAASEEAEPAEGLR_
TRPC4AP Ubiquitylation K303 0.605 _LCK(gl)LATR_
TRPC4AP Ubiquitylation K511 -1.027 0.036 _SLVCDGK(gl)R_
TRPC4AP Ubiquitylation K524 0.398 _LLQVMKK(gl)_
TRPC4AP Ubiquitylation K557 -1.264 0.975 _GTTSYADQMFLLK(gl)R_
TRPC4AP Ubiquitylation K598 -0.059 _FNVDAFK(gl)R_
TSC2 Ubiquitylation K3 -1.397 _(ac)AK(gl)PTSKDSGLK_
TSC2 Ubiquitylation K14 -1.297 _DSGLKEK(gl)FK_
TSC2 Ubiquitylation K69 0.051 _MIGQICEVAK(gl)TK_
TSC2 Ubiquitylation K71 -0.157 _MIGQICEVAKTK(gl)_
TSC2 Ubiquitylation K258 -0.278 _ELCEPCWK(gl)LMR_
TSC2 Ubiquitylation K634 1.610 _LGLPNK(gl)DGVVR_
TSC2 Phosphorylation S950 -0.152 -0.529 _STS(ph)LNERPK_
TSC2 Phosphorylation S1064 -0.927 _SLLGLDSGELQSGPESSSS(ph)PGVHVR_
TSC2 Phosphorylation S1248 -0.604 _SNTDSAVVMEEGS(ph)PGEVPVLVEPPGLEDVEAALGMDRR_
TSC2 Phosphorylation S1329 -0.120 _S(ph)SSSPELQTLQDILGDPGDK_
TSC2 Phosphorylation S1331 -0.262 _SSS(ph)SPELQTLQDILGDPGDKADVGR_
TSC2 Phosphorylation S1332 -0.063 _SSSS(ph)PELQTLQDILGDPGDK_
TSC2 Phosphorylation S1355 0.174 0.351 _ADVGRLS(ph)PEVK_
TSC2 Phosphorylation S1362 0.859 _S(ph)QSGTLDGESAAWSASGEDSR_
TSC2 Phosphorylation S1364 0.522 0.550 _SQS(ph)GTLDGESAAWSASGEDSR_
TSC2 Phosphorylation T1366 0.137 _SQSGT(ph)LDGESAAWSASGEDSR_
TSC2 Phosphorylation S1396 0.498 _S(ph)PSGLRPR_
TSC2 Phosphorylation S1743 0.596 _RLISS(ph)VEDFTEFV_
WNK1 Phosphorylation S2476 -0.727 -0.899 _KEGPVAS(ph)PPFMDLEQAVLPAVIPK_
WNK1 Phosphorylation S2503 -0.810 -0.764 _KEKPELSEPS(ph)HLNGPSSDPEAAFLSR_
WNK1 Phosphorylation S2509 -0.298 _KEKPELSEPSHLNGPS(ph)SDPEAAFLSR_
WNK1 Phosphorylation S2510 -0.532 -0.298 _KEKPELSEPSHLNGPSS(ph)DPEAAFLSR_
WNK1 Phosphorylation S2527 -0.349 _DVDDGSGS(ph)PHSPHQLSSK_
WNK1 Phosphorylation S2530 0.202 -0.225 _DVDDGSGSPHS(ph)PHQLSSK_
WNK2 Phosphorylation S2476 -0.727 -0.899 _KEGPVAS(ph)PPFMDLEQAVLPAVIPK_
WNK2 Phosphorylation S2503 -0.810 -0.764 _KEKPELSEPS(ph)HLNGPSSDPEAAFLSR_
WNK2 Phosphorylation S2509 -0.298 _KEKPELSEPSHLNGPS(ph)SDPEAAFLSR_
WNK2 Phosphorylation S2510 -0.532 -0.298 _KEKPELSEPSHLNGPSS(ph)DPEAAFLSR_
WNK2 Phosphorylation S2527 -0.349 _DVDDGSGS(ph)PHSPHQLSSK_
WNK2 Phosphorylation S2530 0.202 -0.225 _DVDDGSGSPHS(ph)PHQLSSK_
WNK3 Phosphorylation S2476 -0.727 -0.899 _KEGPVAS(ph)PPFMDLEQAVLPAVIPK_
WNK3 Phosphorylation S2503 -0.810 -0.764 _KEKPELSEPS(ph)HLNGPSSDPEAAFLSR_
WNK3 Phosphorylation S2509 -0.298 _KEKPELSEPSHLNGPS(ph)SDPEAAFLSR_
WNK3 Phosphorylation S2510 -0.532 -0.298 _KEKPELSEPSHLNGPSS(ph)DPEAAFLSR_
WNK3 Phosphorylation S2527 -0.349 _DVDDGSGS(ph)PHSPHQLSSK_
WNK3 Phosphorylation S2530 0.202 -0.225 _DVDDGSGSPHS(ph)PHQLSSK_


.

© Copyright Svejstrup Laboratory 2015