bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Category

Results for the Category
RNA polymerase II transcription corepressor activity
(GO:0001106)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

 Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
TCERG1 2 -2.140 3.750 0.359 -0.509 -0.595 -0.336 -0.102
PHF12 1 -0.980 1.740
HDAC1 1 -1.980 4.450
HDAC1 1 -1.980 4.450 -0.122 0.307 0.969 0.094 0.191
TBX15 0 -1.560 1.740
ZMYND8 0 1.480 -1.040
ZMYND8 0 1.480 -1.040 0.151 1.057 1.056 0.009
ZMYND8 0 1.480 -1.040 -0.793 0.183 0.741 0.799 0.587
ZMYND8 0 1.480 -1.040 -0.721 -0.104
RBBP8 0 0.120 0.020
URI1 0 0.510 -0.740
TBX18 0 0.560 -0.160
UXT 0 -1.010 1.010 -0.511
HDGF 0 -0.810 0.160
HDGF 0 -0.810 0.160
NFIB 0 -1.030 1.080 -0.711 0.025 0.306 1.031
CTBP1 0 -0.410 0.390
CTBP1 0 -0.410 0.390 -0.293 -0.875 0.361 0.407 -0.049
CTBP1 0 -0.410 0.390 1.494 -0.398 0.504 0.897 -0.123
SIN3A 0 -0.610 0.780 0.378 -0.208 0.304 -0.168 0.410
TLE1 0 0.270 0.000 0.116

PTM Sites:

 Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
CTBP1 Ubiquitylation K279 0.443 _GGLVDEK(gl)ALAQALK_
CTBP1 Ubiquitylation K286 0.130 0.008 _ALAQALK(gl)EGR_
CTBP1 Phosphorylation S492 -1.548 _YPPGIVGVAPGGLPAAM(ox)EGIIPGGIPVTHNLPTVAHPS(ph)QAPSPNQPTK_
HDAC1 Ubiquitylation K50 0.036 _K(gl)MEIYRPHK_
HDAC1 Ubiquitylation K66 -0.593 _ANAEEMTK(gl)YHSDDYIK_
HDAC1 Ubiquitylation K74 0.620 -1.473 _YHSDDYIK(gl)FLR_
HDAC1 Ubiquitylation K89 0.749 -0.241 _SIRPDNMSEYSK(gl)QMQR_
HDAC1 Phosphorylation S393 -1.133 -1.144 _M(ox)LPHAPGVQM(ox)QAIPEDAIPEES(ph)GDEDEDDPDKR_
HDAC1 Phosphorylation S409 1.326 1.144 _ISICS(ph)SDKR_
HDAC1 Phosphorylation S410 1.326 1.144 _ISICS(ph)SDKR_
HDAC1 Ubiquitylation K412 0.642 -0.744 _ISICSSDK(gl)R_
HDGF Ubiquitylation K11 0.744 _EYK(gl)CGDLVFAK_
HDGF Ubiquitylation K39 0.518 _IDEMPEAAVK(gl)STANK_
HDGF Phosphorylation S148 0.175 0.116 _KGNAEGS(ph)SDEEGKLVIDEPAK_
HDGF Phosphorylation S149 0.156 -0.009 _GNAEGSS(ph)DEEGKLVIDEPAKEK_
HDGF Phosphorylation S181 0.232 0.201 _RAGDLLEDS(ph)PK_
NFIB Phosphorylation S294 -1.873 _TISIDENM(ox)EPSPTGDFYPSPS(ph)SPAAGSR_
NFIB Phosphorylation S295 -1.280 _TISIDENMEPSPTGDFYPSPSS(ph)PAAGSR_
NFIB Phosphorylation S300 -1.728 _TISIDENM(ox)EPSPTGDFYPSPSSPAAGS(ph)R_
NFIB Phosphorylation S311 1.021 0.671 _DQDMS(ph)SPTTM(ox)K_
NFIB Phosphorylation S312 0.764 0.746 _DQDMSS(ph)PTTMK_
NFIB Phosphorylation T314 0.827 _DQDMSSPT(ph)TMK_
NFIB Phosphorylation S325 0.852 _KPEKPLFS(ph)SASPQDSSPR_
NFIB Phosphorylation S328 1.295 0.637 _KPEKPLFSSAS(ph)PQDSSPR_
NFIB Phosphorylation S332 -0.428 -1.102 _KPEKPLFSSASPQDS(ph)SPR_
NFIB Phosphorylation S333 -0.428 _KPEKPLFSSASPQDS(ph)SPR_
PHF12 Phosphorylation T129 5.544 _RT(ph)T(ph)SPS(ph)SDTDLLDRS(ph)ASK_
PHF12 Phosphorylation T130 5.544 _RT(ph)T(ph)SPS(ph)SDTDLLDRS(ph)ASK_
PHF12 Phosphorylation S131 0.403 0.428 _TTS(ph)PSSDTDLLDR_
PHF12 Phosphorylation S133 5.544 _RT(ph)T(ph)SPS(ph)SDTDLLDRS(ph)ASK_
PHF12 Phosphorylation S142 5.544 _RT(ph)T(ph)SPS(ph)SDTDLLDRS(ph)ASK_
PHF12 Phosphorylation T671 -0.003 -0.158 _VLT(ph)PPQAAGDGILATTANQR_
PHF12 Phosphorylation S977 0.955 0.941 _GDAS(ph)LLQDGVLAEK_
RBBP8 Phosphorylation S327 -0.154 0.038 _VSS(ph)PVFGATSSIK_
SIN3A Ubiquitylation K155 0.182 _EFK(gl)SQSIDTPGVISR_
SIN3A Phosphorylation T266 -0.572 _VSKPSQLQAHTPASQQT(ph)PPLPPYASPR_
SIN3A Phosphorylation S277 -1.598 _S(ph)PPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNK_
SIN3A Phosphorylation S295 -1.959 _SPPVQPHTPVTISLGTAPS(ph)LQNNQPVEFNHAINYVNK_
SIN3A Ubiquitylation K638 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K639 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K715 1.012 _GFNK(gl)VWR_
SIN3A Phosphorylation S832 0.764 0.363 _GDLS(ph)DVEEEEEEEM(ox)DVDEATGAVKK_
SIN3A Ubiquitylation K875 0.131 0.003 _LLFSNTAAQK(gl)LR_
SIN3A Ubiquitylation K937 -0.224 -0.025 _DK(gl)SDSPAIQLR_
SIN3A Phosphorylation S940 -0.107 _DKSDS(ph)PAIQLR_
SIN3A Phosphorylation T1111 0.691 0.517 _YM(ox)NSDTT(ph)SPELR_
SIN3A Phosphorylation S1112 0.623 0.725 _YM(ox)NSDTTS(ph)PELR_
TBX15 Ubiquitylation K326 0.687 _NPFAK(gl)GFR_
TBX18 Ubiquitylation K326 0.687 _NPFAK(gl)GFR_
TCERG1 Ubiquitylation K146 0.859 _TPDGK(gl)VYYYNAR_
TCERG1 Ubiquitylation K161 0.421 _ESAWTK(gl)PDGVK_
TCERG1 Ubiquitylation K444 1.501 _TADGK(gl)TYYYNNR_
TCERG1 Ubiquitylation K585 0.547 _GMEELK(gl)K_
TCERG1 Ubiquitylation K586 0.949 _GMEELKK(gl)_
TCERG1 Ubiquitylation K711 1.730 _KQVFDQYVK(gl)TR_
TCERG1 Ubiquitylation K846 1.243 _QYIEK(gl)IAK_
TCERG1 Ubiquitylation K992 0.951 0.162 _CIK(gl)FSSSDR_
TCERG1 Ubiquitylation K1027 2.578 -2.051 _ETK(gl)FITYR_
TLE1 Phosphorylation S286 0.242 0.160 _DASSS(ph)PASTASSASSTSLK_
URI1 Phosphorylation T5 -0.345 _(ac)MEAPT(ph)VETPPDPSPPSAPAPALVPLR_
URI1 Phosphorylation S372 1.094 -0.365 _KNS(ph)TGSGHSAQELPTIR_
URI1 Phosphorylation S440 -0.055 _S(ph)ISCEEATCSDTSESILEEEPQENQK_
URI1 Phosphorylation S442 0.809 0.123 _SIS(ph)CEEATCSDTSESILEEEPQENQKK_
UXT Ubiquitylation K16 -1.728 -0.075 _AVEATGEK(gl)VLR_
UXT Ubiquitylation K41 0.218 _DK(gl)VYEQLAK_
ZMYND8 Phosphorylation S433 0.711 0.935 _LNFDMTAS(ph)PK_
ZMYND8 Phosphorylation S452 1.424 0.458 _RIS(ph)LSDMPR_
ZMYND8 Phosphorylation S487 0.758 0.909 _KATSSHFS(ph)ASEESM(ox)DFLDK_
ZMYND8 Phosphorylation S515 -0.248 _TGQAGSLS(ph)GSPKPFSPQLSAPITTK_
ZMYND8 Phosphorylation S517 -0.203 -0.342 _TGQAGSLSGS(ph)PKPFSPQLSAPITTK_
ZMYND8 Ubiquitylation K535 -0.785 _TDK(gl)TSTTGSILNLNLDR_
ZMYND8 Phosphorylation S574 -0.130 0.057 _ELSESVQQQSTPVPLIS(ph)PKR_
ZMYND8 Phosphorylation S695 0.298 0.206 _DKAS(ph)PEPEKDFSEK_
ZMYND8 Phosphorylation S764 0.454 _EPS(ph)PKQDVVGK_
ZMYND8 Phosphorylation S781 -0.958 _TPPSTTVGS(ph)HSPPETPVLTR_
ZMYND8 Phosphorylation S783 -0.726 -0.795 _TPPSTTVGSHS(ph)PPETPVLTR_


.

© Copyright Svejstrup Laboratory 2015