bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: SMARCA5

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
SMARCA5 0 4.761 0.420 -0.750 0.381 0.398 0.759 0.628 0.494

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
SMARCA5 Ubiquitylation K855 0.872 _DFNQFIK(gl)ANEK_
SMARCA5 Ubiquitylation K847 0.509 _LLTQGFTNWNK(gl)R_
SMARCA5 Ubiquitylation K799 0.558 0.382 _TIGYK(gl)VPR_
SMARCA5 Phosphorylation S116 0.045 -0.051 _TPTS(ph)PLK_
SMARCA5 Phosphorylation S66 -0.501 -0.553 _GGPEGVAAQAVASAASAGPADAEMEEIFDDAS(ph)PGKQK_
SMARCA5 Ubiquitylation K319 -0.811 _SK(gl)LSEIVR_
SMARCA5 Ubiquitylation K929 0.067 -1.279 _YK(gl)APFHQLR_
SMARCA5 Ubiquitylation K160 0.340 _TEQEEDEELLTESSK(gl)ATNVCTR_
SMARCA5 Ubiquitylation K691 0.305 _KTAEMNEK(gl)LSK_
SMARCA5 Ubiquitylation K694 1.235 _LSK(gl)MGESSLR_

Background Information for SMARCA5:


Pubmed-SMARCA5 »
Uniprot-SMARCA5 »
Biogrid-SMARCA5 »
ProteomicsDB-SMARCA5 »

Tumorportal-SMARCA5 »
COSMIC-SMARCA5 »
GenomeRNAi-SMARCA5 »
Genecards-SMARCA5


Protein-protein Interactions for SMARCA5
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait CBX1 Cat. description Hein, Mann, Cell 2015
Category members IP bait DAXX Cat. description Hein, Mann, Cell 2015
Category members IP bait EIF3E Cat. description Hein, Mann, Cell 2015
Category members IP bait FBXO21 Cat. description Hein, Mann, Cell 2015
Category members IP bait HNRNPU Cat. description Hein, Mann, Cell 2015
Category members IP bait NLRP3 Cat. description Hein, Mann, Cell 2015
Category members IP bait NPM1 Cat. description Hein, Mann, Cell 2015
Category members IP bait RPL10 Cat. description Hein, Mann, Cell 2015
Category members IP bait RRBP1 Cat. description Hein, Mann, Cell 2015
Category members IP bait SET Cat. description Hein, Mann, Cell 2015
Category members IP bait RBBP7 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait RPL30 Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in SMARCA5
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members SNF2_N IPR000330 3.38
Category members P-loop_NTPase IPR027417 2.83
Category members Helicase_C IPR001650 2.48
Category members Helicase_ATP-bd IPR014001 2.48
Category members SANT/Myb IPR001005 2.18
Category members Helicase/UvrB_dom IPR006935 0.78
Category members DEAD/DEAH_box_helicase_dom IPR011545 0.35
Category members ISWI_HAND-dom IPR015194 0.33
Category members SLIDE IPR015195 0.33
Category members HDA_complex_subunit-2/3 IPR021006 0.04
Category members Homeodomain-like IPR009057 0


Protein complexes (CORUM database) featuring SMARCA5
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members Corum 282 SNF2h-cohesin-NuRD complex Database 6.11
Category members Corum 1257 ALL-1 supercomplex Database 4.3
Category members Corum 929 CEN complex Database 3.25
Category members Corum 116 Polycomb repressive complex 1 (PRC1, hPRC-H) Database 1.56
Category members Corum 115 Polycomb repressive complex 1 (PRC1, hPRC-H) Database 1.28
Category members Corum 49 DNMT3B complex Database 1.05
Category members Corum 1458 SNF2h-HDAC12 complex Database 0.33
Category members Corum 5694 Nucleolar remodeling complex (NoRC complex) Database 0.33
Category members Corum 921 Remodeling and spacing factor (RSF) complex Database 0.33
Category members Corum 925 WCRF complex Database 0.33
Category members Corum 94 ATP-utilizing chromatin assembly and remodeling factor (hACF) complex Database 0.33
Category members Corum 236 WICH complex Database 0.3
Category members Corum 234 HuCHRAC complex Database 0.02


Categories featuring SMARCA5
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members DDR Literature pubmedid:24332808 Marechal et al., 2014 RPA-mediated recruitment INF
Category members GO Category GO:0005515 protein binding Database INF
Category members GO Category GO:0005634 nucleus Database INF
Category members GO Category GO:0005654 nucleoplasm Database INF
Category members GO Category GO:0005730 nucleolus Database 13.38
Category members Pathway Pathway_320 REACTOME_CELL_CYCLE 0 11.08
Category members Pathway Pathway_319 REACTOME_CHROMOSOME_MAINTENANCE 0 7.37
Category members GO Category GO:0003682 chromatin binding Database 6.07
Category members GO Category GO:0005524 ATP binding Database 5.54
Category members GO Category GO:0006338 chromatin remodeling Database 4.95
Category members GO Category GO:0034080 CENP-A containing nucleosome assembly at centromere Database 4.75
Category members GO Category GO:0006302 double-strand break repair Database 4.62
Category members Pathway Pathway_1281 REACTOME_DEPOSITION_OF_NEW_CENPA_CONTAINING_NUCLEOSOMES_AT_THE_CENTROMERE 0 4.19
Category members GO Category GO:0006334 nucleosome assembly Database 3.77
Category members GO Category GO:0006352 DNA-dependent transcription, initiation Database 3.76
Category members GO Category GO:0004386 helicase activity Database 2.49
Category members GO Category GO:0016887 ATPase activity Database 2.28
Category members GO Category GO:0006200 ATP catabolic process Database 2.13
Category members GO Category GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides Database 1.64
Category members GO Category GO:0003677 DNA binding Database 1.53
Category members GO Category GO:0043044 ATP-dependent chromatin remodeling Database 1.41
Category members GO Category GO:0016589 NURF complex Database 1.33
Category members GO Category GO:0000793 condensed chromosome Database 1.32
Category members GO Category GO:0042393 histone binding Database 0.94
Category members GO Category GO:0003676 nucleic acid binding Database 0.83
Category members GO Category GO:0008026 ATP-dependent helicase activity Database 0.79
Category members GO Category GO:0006333 chromatin assembly or disassembly Database 0.48
Category members GO Category GO:0031213 RSF complex Database 0.33
Category members GO Category GO:0045893 positive regulation of transcription, DNA-dependent Database 0.28
Category members GO Category GO:0000183 chromatin silencing at rDNA Database 0.24
Category members GO Category GO:0031491 nucleosome binding Database 0.24
Category members GO Category GO:0043596 nuclear replication fork Database 0.23
Category members GO Category GO:0016787 hydrolase activity Database 0.22
Category members GO Category GO:0006357 regulation of transcription from RNA polymerase II promoter Database 0.19
Category members Disease phenotype Extraskeletal_Ewing_sarcoma Extraskeletal Ewing sarcoma Database 0
Category members GO Category GO:0005677 chromatin silencing complex Database 0
Category members GO Category GO:0009790 embryo development Database 0
Category members GO Category GO:0016584 nucleosome positioning Database 0
Category members GO Category GO:0031010 ISWI-type complex Database 0


.

© Copyright Svejstrup Laboratory 2015