bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
ISWI-type complex
(GO:0031010)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
CECR2 0 1.060 -0.940 -1.272 0.502 0.344
SMARCA5 0 0.420 -0.750 0.381 0.398 0.759 0.628 0.494

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
SMARCA5 Phosphorylation S66 -0.501 -0.553 _GGPEGVAAQAVASAASAGPADAEMEEIFDDAS(ph)PGKQK_
SMARCA5 Phosphorylation S116 0.045 -0.051 _TPTS(ph)PLK_
SMARCA5 Ubiquitylation K160 0.340 _TEQEEDEELLTESSK(gl)ATNVCTR_
SMARCA5 Ubiquitylation K319 -0.811 _SK(gl)LSEIVR_
SMARCA5 Ubiquitylation K691 0.305 _KTAEMNEK(gl)LSK_
SMARCA5 Ubiquitylation K694 1.235 _LSK(gl)MGESSLR_
SMARCA5 Ubiquitylation K799 0.558 0.382 _TIGYK(gl)VPR_
SMARCA5 Ubiquitylation K847 0.509 _LLTQGFTNWNK(gl)R_
SMARCA5 Ubiquitylation K855 0.872 _DFNQFIK(gl)ANEK_
SMARCA5 Ubiquitylation K929 0.067 -1.279 _YK(gl)APFHQLR_


© Copyright Svejstrup Laboratory 2015