bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
Nucleolar remodeling complex (NoRC complex)
(5694)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
BAZ2A 1 1.510 -0.870 0.975 0.004 0.169
SMARCA5 0 0.420 -0.750 0.381 0.398 0.759 0.628 0.494

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
BAZ2A Phosphorylation S134 0.353 _QPS(ph)SPSHNTNLR_
BAZ2A Phosphorylation S135 0.630 0.353 _QPSS(ph)PSHNTNLR_
BAZ2A Phosphorylation S496 -0.011 -0.671 _AS(ph)PVTSPAAAFPTASPANK_
BAZ2A Phosphorylation S509 -1.087 _ASPVTSPAAAFPTAS(ph)PANK_
BAZ2A Phosphorylation S1397 -0.280 -0.363 _AGDPGEM(ox)PQS(ph)PTGLGQPK_
BAZ2A Ubiquitylation K1672 0.317 _SIAWEK(gl)SVNK_
BAZ2A Phosphorylation S1783 0.234 0.093 _YSEEGLS(ph)PSK_
BAZ2A Ubiquitylation K1786 1.625 _YSEEGLSPSK(gl)R_
BAZ2A Ubiquitylation K1901 -0.315 _WEEFYQGK(gl)QANL_
SMARCA5 Phosphorylation S66 -0.501 -0.553 _GGPEGVAAQAVASAASAGPADAEMEEIFDDAS(ph)PGKQK_
SMARCA5 Phosphorylation S116 0.045 -0.051 _TPTS(ph)PLK_
SMARCA5 Ubiquitylation K160 0.340 _TEQEEDEELLTESSK(gl)ATNVCTR_
SMARCA5 Ubiquitylation K319 -0.811 _SK(gl)LSEIVR_
SMARCA5 Ubiquitylation K691 0.305 _KTAEMNEK(gl)LSK_
SMARCA5 Ubiquitylation K694 1.235 _LSK(gl)MGESSLR_
SMARCA5 Ubiquitylation K799 0.558 0.382 _TIGYK(gl)VPR_
SMARCA5 Ubiquitylation K847 0.509 _LLTQGFTNWNK(gl)R_
SMARCA5 Ubiquitylation K855 0.872 _DFNQFIK(gl)ANEK_
SMARCA5 Ubiquitylation K929 0.067 -1.279 _YK(gl)APFHQLR_


© Copyright Svejstrup Laboratory 2015