Results for the Category
ATP-utilizing chromatin assembly and remodeling factor (hACF) complex
(94)
RNAi screen result | RNAPII IP (MG132) | CSB IP | CSB IP (MG132) | Chrom. | Chrom. (MG132) | Ubi /Phospo | Ubi /Phospho (MG132) |
W | |||||||
Gene name | MGoogle Score | RNAi high | RNAi low | RNAPII-IP (MG132) | CSB-IP | CSB-IP (MG132) | Chrom. | Chrom. (MG132) |
---|---|---|---|---|---|---|---|---|
BAZ1A | 1 | 1.600 | -0.840 | 0.255 | 0.401 | 0.236 | 0.064 | 0.088 |
SMARCA5 | 0 | 0.420 | -0.750 | 0.381 | 0.398 | 0.759 | 0.628 | 0.494 |
Gene name | PTM type | PTM site | UV | UV (MG132) | Sequence |
---|---|---|---|---|---|
BAZ1A | Ubiquitylation | K387 | 2.679 | _K(gl)YVEYLK_ | |
BAZ1A | Ubiquitylation | K598 | -0.245 | 1.101 | _LSNPSLVK(gl)K_ |
BAZ1A | Ubiquitylation | K599 | 0.354 | _LSNPSLVKK(gl)_ | |
BAZ1A | Phosphorylation | T731 | 0.334 | 0.083 | _ELDQDMVT(ph)EDEDDPGSHK_ |
BAZ1A | Ubiquitylation | K973 | -0.227 | -0.485 | _SSNAYDPSQMCAEK(gl)QLELR_ |
BAZ1A | Phosphorylation | S1019 | 0.477 | 0.773 | _YELLS(ph)EENKENGIIK_ |
BAZ1A | Phosphorylation | S1283 | 0.833 | 0.346 | _LSSSFS(ph)SR_ |
BAZ1A | Phosphorylation | S1413 | -0.574 | -0.355 | _RQS(ph)PEPSPVTLGR_ |
BAZ1A | Phosphorylation | S1546 | -0.396 | _LGLHVTPSNVDQVS(ph)TPPAAK_ | |
BAZ1A | Phosphorylation | T1547 | -0.504 | -0.584 | _LGLHVTPSNVDQVST(ph)PPAAK_ |
SMARCA5 | Phosphorylation | S66 | -0.501 | -0.553 | _GGPEGVAAQAVASAASAGPADAEMEEIFDDAS(ph)PGKQK_ |
SMARCA5 | Phosphorylation | S116 | 0.045 | -0.051 | _TPTS(ph)PLK_ |
SMARCA5 | Ubiquitylation | K160 | 0.340 | _TEQEEDEELLTESSK(gl)ATNVCTR_ | |
SMARCA5 | Ubiquitylation | K319 | -0.811 | _SK(gl)LSEIVR_ | |
SMARCA5 | Ubiquitylation | K691 | 0.305 | _KTAEMNEK(gl)LSK_ | |
SMARCA5 | Ubiquitylation | K694 | 1.235 | _LSK(gl)MGESSLR_ | |
SMARCA5 | Ubiquitylation | K799 | 0.558 | 0.382 | _TIGYK(gl)VPR_ |
SMARCA5 | Ubiquitylation | K847 | 0.509 | _LLTQGFTNWNK(gl)R_ | |
SMARCA5 | Ubiquitylation | K855 | 0.872 | _DFNQFIK(gl)ANEK_ | |
SMARCA5 | Ubiquitylation | K929 | 0.067 | -1.279 | _YK(gl)APFHQLR_ |
.
© Copyright Svejstrup Laboratory 2015