bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
HuCHRAC complex
(234)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
BAZ1A 1 1.600 -0.840 0.255 0.401 0.236 0.064 0.088
CHRAC1 0 0.360 0.340 -0.305 0.651
POLE3 0 -0.830 0.170 -0.901 -0.263
SMARCA5 0 0.420 -0.750 0.381 0.398 0.759 0.628 0.494

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
BAZ1A Ubiquitylation K387 2.679 _K(gl)YVEYLK_
BAZ1A Ubiquitylation K598 -0.245 1.101 _LSNPSLVK(gl)K_
BAZ1A Ubiquitylation K599 0.354 _LSNPSLVKK(gl)_
BAZ1A Phosphorylation T731 0.334 0.083 _ELDQDMVT(ph)EDEDDPGSHK_
BAZ1A Ubiquitylation K973 -0.227 -0.485 _SSNAYDPSQMCAEK(gl)QLELR_
BAZ1A Phosphorylation S1019 0.477 0.773 _YELLS(ph)EENKENGIIK_
BAZ1A Phosphorylation S1283 0.833 0.346 _LSSSFS(ph)SR_
BAZ1A Phosphorylation S1413 -0.574 -0.355 _RQS(ph)PEPSPVTLGR_
BAZ1A Phosphorylation S1546 -0.396 _LGLHVTPSNVDQVS(ph)TPPAAK_
BAZ1A Phosphorylation T1547 -0.504 -0.584 _LGLHVTPSNVDQVST(ph)PPAAK_
POLE3 Ubiquitylation K31 -0.408 -0.365 _EALPDGVNISK(gl)EAR_
SMARCA5 Phosphorylation S66 -0.501 -0.553 _GGPEGVAAQAVASAASAGPADAEMEEIFDDAS(ph)PGKQK_
SMARCA5 Phosphorylation S116 0.045 -0.051 _TPTS(ph)PLK_
SMARCA5 Ubiquitylation K160 0.340 _TEQEEDEELLTESSK(gl)ATNVCTR_
SMARCA5 Ubiquitylation K319 -0.811 _SK(gl)LSEIVR_
SMARCA5 Ubiquitylation K691 0.305 _KTAEMNEK(gl)LSK_
SMARCA5 Ubiquitylation K694 1.235 _LSK(gl)MGESSLR_
SMARCA5 Ubiquitylation K799 0.558 0.382 _TIGYK(gl)VPR_
SMARCA5 Ubiquitylation K847 0.509 _LLTQGFTNWNK(gl)R_
SMARCA5 Ubiquitylation K855 0.872 _DFNQFIK(gl)ANEK_
SMARCA5 Ubiquitylation K929 0.067 -1.279 _YK(gl)APFHQLR_


© Copyright Svejstrup Laboratory 2015