bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
nuclear replication fork
(GO:0043596)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
PCNA 2 -0.730 0.380 0.679 1.154 0.572 0.718 0.782
SMARCAD1 2 0.070 0.540 -0.030 1.060 0.612 0.381 0.353
TONSL 1 -1.900 3.540 -0.261 -3.160 0.665 1.051
ZRANB3 0 -0.760 1.140
ZMIZ2 0 -0.240 0.580
MMS22L 0 0.598 0.329
SMARCA5 0 0.420 -0.750 0.381 0.398 0.759 0.628 0.494

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
PCNA Ubiquitylation K13 0.209 2.207 _LVQGSILK(gl)K_
PCNA Ubiquitylation K14 0.233 2.833 _LVQGSILKK(gl)_
PCNA Ubiquitylation K80 0.570 1.579 _ILK(gl)CAGNEDIITLR_
PCNA Ubiquitylation K164 2.309 2.671 _DLSHIGDAVVISCAK(gl)DGVK_
PCNA Ubiquitylation K168 2.484 2.645 _DLSHIGDAVVISCAKDGVK(gl)_
PCNA Ubiquitylation K248 0.226 0.515 _IADMGHLK(gl)YYLAPK_
SMARCA5 Phosphorylation S66 -0.501 -0.553 _GGPEGVAAQAVASAASAGPADAEMEEIFDDAS(ph)PGKQK_
SMARCA5 Phosphorylation S116 0.045 -0.051 _TPTS(ph)PLK_
SMARCA5 Ubiquitylation K160 0.340 _TEQEEDEELLTESSK(gl)ATNVCTR_
SMARCA5 Ubiquitylation K319 -0.811 _SK(gl)LSEIVR_
SMARCA5 Ubiquitylation K691 0.305 _KTAEMNEK(gl)LSK_
SMARCA5 Ubiquitylation K694 1.235 _LSK(gl)MGESSLR_
SMARCA5 Ubiquitylation K799 0.558 0.382 _TIGYK(gl)VPR_
SMARCA5 Ubiquitylation K847 0.509 _LLTQGFTNWNK(gl)R_
SMARCA5 Ubiquitylation K855 0.872 _DFNQFIK(gl)ANEK_
SMARCA5 Ubiquitylation K929 0.067 -1.279 _YK(gl)APFHQLR_
SMARCAD1 Phosphorylation T54 -0.579 -0.089 _ANT(ph)PDSDITEK_
SMARCAD1 Phosphorylation S79 1.866 0.866 _KAS(ph)ISYFK_
SMARCAD1 Phosphorylation S95 -0.165 _GIQYIDLS(ph)SDSEDVVSPNCSNTVQEK_
SMARCAD1 Phosphorylation S152 1.382 1.569 _RNDDISELEDLS(ph)ELEDLKDAK_
SMARCAD1 Phosphorylation S211 0.248 _KLS(ph)SSSEPYEEDEFNDDQSIKK_
TONSL Ubiquitylation K336 -1.432 _AAEAYQK(gl)QLR_
TONSL Phosphorylation S719 -0.359 -0.212 _VS(ph)PGQAAPAMARPR_
ZMIZ2 Ubiquitylation K559 -0.155 _SVLQGLLKK(gl)_
ZRANB3 Ubiquitylation K163 -0.845 _VVIVDESHYMK(gl)SR_
ZRANB3 Ubiquitylation K179 -1.035 _ILLPIVQK(gl)AR_


© Copyright Svejstrup Laboratory 2015