bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
NURF complex
(GO:0016589)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
SMARCA1 2 0.820 0.230 1.940 0.165 0.532 1.513 0.625
RBBP4 1 2.110 -1.240 0.533 -0.610 0.648
HMGXB4 0 -0.280 0.860 0.982 0.423
HMGXB4 0 -0.280 0.860
SMARCA5 0 0.420 -0.750 0.381 0.398 0.759 0.628 0.494
C17orf49 0 0.008 0.869
C17orf49 0

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
C17orf49 Phosphorylation S76 -0.693 -0.492 _LGELTMQLHPVADS(ph)SPAGAK_
C17orf49 Phosphorylation S77 -0.644 -0.371 _LGELTMQLHPVADSS(ph)PAGAK_
C17orf49 Phosphorylation S137 -0.589 -0.859 _VYEDSGIPLPAES(ph)PKKGPK_
C17orf49 Phosphorylation S147 -1.632 -1.957 _VAS(ph)GVLSPPPAAPPPSSSSVPEAGGPPIK_
C17orf49 Phosphorylation S151 -1.596 -2.794 _VASGVLS(ph)PPPAAPPPSSSSVPEAGGPPIK_
HMGXB4 Phosphorylation S101 0.398 0.441 _S(ph)SPQSTDTAMDLLK_
HMGXB4 Phosphorylation S102 0.689 0.609 _KSS(ph)PQSTDTAMDLLK_
HMGXB4 Phosphorylation S497 0.369 0.453 _ASSVGVLS(ph)PQKK_
HMGXB4 Phosphorylation S502 -0.673 -0.959 _S(ph)PPTTMLLPAS(ph)PAK_
HMGXB4 Phosphorylation S512 -0.673 -0.959 _S(ph)PPTTM(ox)LLPAS(ph)PAK_
RBBP4 Ubiquitylation K4 0.699 0.574 _(ac)ADK(gl)EAAFDDAVEER_
RBBP4 Ubiquitylation K160 -1.765 _HPSK(gl)PDPSGECNPDLR_
SMARCA1 Phosphorylation T118 -0.873 -0.490 _SPT(ph)SPLNMK_
SMARCA1 Ubiquitylation K862 1.344 _LLTQGFTNWTK(gl)R_
SMARCA5 Phosphorylation S66 -0.501 -0.553 _GGPEGVAAQAVASAASAGPADAEMEEIFDDAS(ph)PGKQK_
SMARCA5 Phosphorylation S116 0.045 -0.051 _TPTS(ph)PLK_
SMARCA5 Ubiquitylation K160 0.340 _TEQEEDEELLTESSK(gl)ATNVCTR_
SMARCA5 Ubiquitylation K319 -0.811 _SK(gl)LSEIVR_
SMARCA5 Ubiquitylation K691 0.305 _KTAEMNEK(gl)LSK_
SMARCA5 Ubiquitylation K694 1.235 _LSK(gl)MGESSLR_
SMARCA5 Ubiquitylation K799 0.558 0.382 _TIGYK(gl)VPR_
SMARCA5 Ubiquitylation K847 0.509 _LLTQGFTNWNK(gl)R_
SMARCA5 Ubiquitylation K855 0.872 _DFNQFIK(gl)ANEK_
SMARCA5 Ubiquitylation K929 0.067 -1.279 _YK(gl)APFHQLR_


© Copyright Svejstrup Laboratory 2015