bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
BIOCARTA_PYK2_PATHWAY
(Pathway_693)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
JUN 3 -0.930 0.930 -0.126
MAPK14 2 -0.160 -0.350
PLCG1 1 -0.170 0.000
RAF1 1 2.020 -1.230
CALM2 1 -0.690 0.700 1.911
CALM2 1 -0.690 0.700 0.877 -4.680
CALM3 1 -0.190 0.120 1.911
CALM3 1 -0.190 0.120 0.877 -4.680
MAP2K1 1 -1.590 2.780
CALM1 1 -0.440 0.360 1.911
CALM1 1 -0.440 0.360 0.877 -4.680
MAP2K3 0 0.780 -0.600
MAP2K4 0 -0.300 0.320
MAP3K1 0 0.750 -1.270
CRKL 0 0.290 -0.620
MAPK3 0
SOS1 0 0.500 -0.620 -0.570
MAP2K2 0 -0.610 0.080
MAP2K2 0 -0.610 0.080
RAC1 0 -0.580 1.580 0.486 -0.364 -0.568
PAK1 0 1.190 -0.630
PRKCA 0 0.750 -0.690 0.349 0.585
PRKCA 0 0.750 -0.690
GNAQ 0 0.140 -0.310 0.052 0.449
PRKCB 0 0.260 -0.530
PRKCB 0 0.260 -0.530 0.349 0.585
HRAS 0 1.470 -0.520
GRB2 0 -0.240 0.300 -1.021 0.057 0.906
SRC 0 0.050 0.470 -0.031

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
CALM1 Ubiquitylation K78 0.061 _DGDGTITTK(gl)ELGTVMR_
CALM1 Ubiquitylation K142 0.922 _VFDK(gl)DGNGYISAAELR_
CALM2 Ubiquitylation K78 0.061 _DGDGTITTK(gl)ELGTVMR_
CALM2 Ubiquitylation K142 0.922 _VFDK(gl)DGNGYISAAELR_
CALM3 Ubiquitylation K78 0.061 _DGDGTITTK(gl)ELGTVMR_
CALM3 Ubiquitylation K142 0.922 _VFDK(gl)DGNGYISAAELR_
CRKL Phosphorylation S41 0.868 _DS(ph)STCPGDYVLSVSENSR_
CRKL Phosphorylation S107 -0.818 -1.177 _YPS(ph)PPMGSVSAPNLPTAEDNLEYVR_
GNAQ Ubiquitylation K16 0.245 _TLESIMACCLSEEAK(gl)EAR_
GNAQ Ubiquitylation K102 -0.299 _IPYK(gl)YEHNK_
GRB2 Ubiquitylation K10 0.146 _YDFK(gl)ATADDELSFK_
GRB2 Ubiquitylation K20 -0.078 _ATADDELSFK(gl)R_
GRB2 Ubiquitylation K69 -0.362 0.641 _AK(gl)AEEMLSK_
GRB2 Ubiquitylation K76 0.754 _AEEMLSK(gl)QR_
GRB2 Ubiquitylation K109 0.381 -0.002 _FGNDVQHFK(gl)VLR_
HRAS Ubiquitylation K170 -1.005 _K(gl)LNPPDESGPGCMSCK_
JUN Phosphorylation S58 -0.167 -1.247 _AKNS(ph)DLLTSPDVGLLK_
JUN Phosphorylation T62 2.545 1.674 _NSDLLT(ph)SPDVGLLK_
JUN Phosphorylation S63 2.030 1.458 _NSDLLTS(ph)PDVGLLK_
JUN Ubiquitylation K70 9.213 _NSDLLTSPDVGLLK(gl)_
JUN Phosphorylation S73 1.499 0.845 _LAS(ph)PELER_
JUN Phosphorylation S243 -0.642 -1.399 _LQALKEEPQTVPEMPGETPPLS(ph)PIDMESQER_
JUN Ubiquitylation K309 1.034 0.155 _EQVAQLK(gl)QK_
MAP2K1 Ubiquitylation K192 -0.205 -0.241 _DVK(gl)PSNILVNSR_
MAP2K1 Phosphorylation S385 0.066 _RSDAEEVDFAGWLCSTIGLNQPS(ph)TPTHAAGV_
MAP2K1 Phosphorylation T386 0.377 _RSDAEEVDFAGWLCSTIGLNQPST(ph)PTHAAGV_
MAP2K2 Phosphorylation S23 0.873 0.258 _RKPVLPALTINPTIAEGPS(ph)PTSEGASEANLVDLQK_
MAP2K2 Phosphorylation T25 0.439 _RKPVLPALTINPTIAEGPSPT(ph)SEGASEANLVDLQK_
MAP2K2 Ubiquitylation K192 -0.205 -0.241 _DVK(gl)PSNILVNSR_
MAP2K2 Phosphorylation S293 -0.361 _ELEAIFGRPVVDGEEGEPHS(ph)ISPR_
MAP2K2 Phosphorylation S295 -0.234 0.026 _ELEAIFGRPVVDGEEGEPHSIS(ph)PR_
MAP2K2 Phosphorylation T394 0.570 0.158 _LNQPGT(ph)PTR_
MAP2K3 Ubiquitylation K84 0.045 -0.277 _GAYGVVEK(gl)VR_
MAP2K3 Ubiquitylation K232 -1.394 _TMDAGCK(gl)PYMAPER_
MAP2K3 Ubiquitylation K247 0.065 -0.737 _INPELNQK(gl)GYNVK_
MAP2K4 Phosphorylation S80 0.441 _LRTHS(ph)IESSGK_
MAP3K1 Phosphorylation S292 0.209 _RAPS(ph)PDGFSPYSPEETNR_
MAP3K1 Phosphorylation S506 1.427 _SHDFYSHELS(ph)SPVDSPSSLR_
MAP3K1 Phosphorylation S507 1.436 _SHDFYSHELSS(ph)PVDSPSSLR_
MAP3K1 Phosphorylation S923 0.127 -0.120 _LSAS(ph)SEDISER_
MAPK14 Phosphorylation S2 3.221 3.623 _(ac)S(ph)QERPTFYR_
MAPK14 Phosphorylation T180 0.958 1.087 _HTDDEM(ox)T(ph)GYVATR_
MAPK14 Phosphorylation Y182 1.388 1.374 _HTDDEM(ox)TGY(ph)VATR_
MAPK14 Ubiquitylation K249 0.073 -1.380 _LVGTPGAELLKK(gl)_
MAPK3 Phosphorylation Y204 -0.807 -2.487 _IADPEHDHTGFLTEY(ph)VATR_
MAPK3 Ubiquitylation K289 -0.608 _NYLQSLPSKTK(gl)_
PAK1 Phosphorylation S174 -1.439 -0.597 _AVSETPAVPPVS(ph)EDEDDDDDDATPPPVIAPRPEHTK_
PAK1 Phosphorylation T212 0.312 _SVIEPLPVT(ph)PTR_
PAK1 Phosphorylation T219 -0.560 -0.962 _DVAT(ph)SPISPTENNTT(ph)PPDALTR_
PAK1 Phosphorylation S220 -0.916 -0.774 _DVATS(ph)PISPTENNTTPPDALTR_
PAK1 Phosphorylation S223 1.033 0.153 _DVATSPIS(ph)PTENNTTPPDALTR_
PAK1 Phosphorylation T225 -1.278 _DVATSPISPT(ph)ENNTTPPDALTR_
PAK1 Phosphorylation T230 -1.418 -1.502 _DVATSPISPTENNTT(ph)PPDALTR_
PLCG1 Ubiquitylation K300 8.031 _DLK(gl)NMLSQVNYR_
PLCG1 Ubiquitylation K348 -0.219 _SLMYSAQK(gl)TMDLPFLEASTLR_
PLCG1 Ubiquitylation K552 -0.355 _NMAQYFK(gl)K_
PLCG1 Ubiquitylation K553 -0.355 _NMAQYFK(gl)K_
PLCG1 Ubiquitylation K1063 0.864 0.355 _LTEGK(gl)IMER_
PLCG1 Phosphorylation S1370 0.475 0.515 _AREGS(ph)FESR_
PRKCA Phosphorylation S10 -0.650 0.036 _(ac)ADVFPGNDS(ph)TASQDVANR_
PRKCA Phosphorylation S13 -1.038 0.335 _(ac)ADVFPGNDSTAS(ph)QDVANR_
PRKCA Phosphorylation S226 0.693 0.415 _STLNPQWNES(ph)FTFK_
PRKCA Ubiquitylation K316 -0.522 -0.535 _LGPAGNK(gl)VISPSEDR_
PRKCB Phosphorylation S10 -0.650 0.036 _(ac)ADVFPGNDS(ph)TASQDVANR_
PRKCB Phosphorylation S13 -1.038 0.335 _(ac)ADVFPGNDSTAS(ph)QDVANR_
PRKCB Phosphorylation S226 0.693 0.415 _STLNPQWNES(ph)FTFK_
PRKCB Ubiquitylation K315 0.213 0.518 _ISQGTK(gl)VPEEK_
RAC1 Ubiquitylation K115 -1.745 -0.215 _AK(gl)WYPEVR_
RAC1 Ubiquitylation K142 0.492 _LDLRDDK(gl)DTIEK_
RAC1 Ubiquitylation K152 0.099 -0.292 _K(gl)LTPITYPQGLAMAK_
RAC1 Ubiquitylation K166 -0.981 -0.655 _LTPITYPQGLAMAK(gl)EIGAVK_
RAC1 Ubiquitylation K172 1.026 0.412 _EIGAVK(gl)YLECSALTQR_
RAC1 Ubiquitylation K185 -0.113 0.578 _GLK(gl)TVFDEAIR_
RAC1 Ubiquitylation K202 -1.379 -1.447 _AVLCPPPVK(gl)KR_
RAC1 Ubiquitylation K203 -1.708 -1.447 _AVLCPPPVKK(gl)_
RAF1 Phosphorylation S29 0.028 -0.571 _DAVFDGSSCIS(ph)PTIVQQFGYQR_
RAF1 Phosphorylation T31 0.028 -0.669 _DAVFDGSSCIS(ph)PTIVQQFGYQR_
RAF1 Phosphorylation S244 0.053 _YSTPHAFTFNTSS(ph)PSSEGSLSQR_
RAF1 Phosphorylation S259 -0.069 0.054 _STS(ph)TPNVHM(ox)VSTTLPVDSR_
RAF1 Phosphorylation S301 -0.651 _SHSESASPSALSSSPNNLS(ph)PTGWSQPK_
RAF1 Phosphorylation T303 -0.664 _SHSESASPSALSSSPNNLSPT(ph)GWSQPK_
RAF1 Phosphorylation S497 -0.449 _SRWS(ph)GSQQVEQPTGSVLWMAPEVIR_
RAF1 Phosphorylation S621 0.212 0.271 _SAS(ph)EPSLHR_
RAF1 Phosphorylation S642 -0.197 0.463 _AAHTEDINACTLTTS(ph)PR_
SOS1 Phosphorylation S1082 0.278 _IPESETESTASAPNS(ph)PR_
SOS1 Phosphorylation S1166 0.097 -0.094 _RPESAPAES(ph)SPSK_
SRC Phosphorylation S17 -0.604 -0.689 _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_
SRC Phosphorylation S75 0.060 0.331 _LFGGFNSSDTVTS(ph)PQR_


© Copyright Svejstrup Laboratory 2015