bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
response to interleukin-1
(GO:0070555)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
RIPK2 1 -1.740 3.580
ETS1 1 1.070 -0.650
ANXA1 1 1.050 -0.850 1.883
HDAC4 0 1.730 -0.740
AES 0 -0.830 1.120 -1.378
PRKCA 0 0.750 -0.690 0.349 0.585
PRKCA 0 0.750 -0.690
PRKCI 0 0.730 -0.460 1.483 0.192 0.350
RELA 0 -1.130 1.600 0.793
MTHFR 0 -0.450 0.210 -0.418
SRC 0 0.050 0.470 -0.031

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
AES Ubiquitylation K54 0.449 _LASEK(gl)SEMQR_
AES Ubiquitylation K83 0.433 _QAEIVK(gl)R_
AES Ubiquitylation K112 -1.428 -0.846 _AK(gl)QVTAPELNSIIR_
ETS1 Ubiquitylation K416 7.479 _MNYEK(gl)LSR_
ETS1 Ubiquitylation K427 -0.895 _YYYDK(gl)NIIHK_
HDAC4 Phosphorylation S265 -0.390 _RS(ph)SPLLR_
HDAC4 Phosphorylation S266 -0.821 -0.598 _RSS(ph)PLLR_
HDAC4 Phosphorylation S632 -1.146 -0.837 _AQS(ph)SPASATFPVSVQEPPTKPR_
PRKCA Phosphorylation S10 -0.650 0.036 _(ac)ADVFPGNDS(ph)TASQDVANR_
PRKCA Phosphorylation S13 -1.038 0.335 _(ac)ADVFPGNDSTAS(ph)QDVANR_
PRKCA Phosphorylation S226 0.693 0.415 _STLNPQWNES(ph)FTFK_
PRKCA Ubiquitylation K316 -0.522 -0.535 _LGPAGNK(gl)VISPSEDR_
PRKCI Ubiquitylation K244 0.289 _ESGK(gl)ASSSLGLQDFDLLR_
PRKCI Ubiquitylation K488 -0.090 0.847 _SLSVK(gl)AASVLK_
RIPK2 Ubiquitylation K410 -2.810 _AAFCDHK(gl)TTPCSSAIINPLSTAGNSER_
RIPK2 Phosphorylation S531 0.884 0.839 _SPS(ph)LNLLQNK_
RIPK2 Ubiquitylation K538 -2.659 _SPSLNLLQNK(gl)SM_
SRC Phosphorylation S17 -0.604 -0.689 _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_
SRC Phosphorylation S75 0.060 0.331 _LFGGFNSSDTVTS(ph)PQR_


© Copyright Svejstrup Laboratory 2015