bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
PID_UPA_UPAR_PATHWAY
(Pathway_710)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
NCL 3 -0.530 0.500 -0.279 -0.044 0.135
TGFB1 0 -0.550 1.050
LRP1 0 -0.360 0.400 1.199 1.016
RAC1 0 -0.580 1.580 0.486 -0.364 -0.568
ITGAV 0 -0.297 -0.090 0.262
EGFR 0 -0.580 0.520 0.513 0.090
ITGB1 0 0.390 -0.650 0.101 -0.036
ITGA5 0 0.320 -0.520 0.858 0.617
CRK 0 -0.790 0.230
FGA 0 -5.029
FGB 0 0.920 -1.250 -4.320
SRC 0 0.050 0.470 -0.031

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
CRK Phosphorylation S40 0.533 0.363 _DS(ph)STSPGDYVLSVSENSR_
CRK Phosphorylation S41 1.065 0.801 _DSS(ph)TSPGDYVLSVSENSR_
EGFR Phosphorylation T693 0.486 -0.139 _ELVEPLT(ph)PSGEAPNQALLR_
EGFR Phosphorylation S991 -0.041 _MHLPS(ph)PTDSNFYR_
ITGA5 Phosphorylation S127 0.200 0.067 _LLESSLSS(ph)SEGEEPVEYK_
ITGA5 Phosphorylation S128 -0.087 _LLESSLSSS(ph)EGEEPVEYK_
ITGAV Ubiquitylation K233 0.373 _YDPNVYSIK(gl)YNNQLATR_
ITGAV Ubiquitylation K360 0.294 _ASGDFQTTK(gl)LNGFEVFAR_
ITGAV Ubiquitylation K923 0.636 _GK(gl)SAILYVK_
ITGB1 Ubiquitylation K774 0.402 _MNAK(gl)WDTGENPIYK_
ITGB1 Ubiquitylation K784 -0.172 0.350 _WDTGENPIYK(gl)SAVTTVVNPK_
ITGB1 Ubiquitylation K794 0.755 0.604 _SAVTTVVNPK(gl)YEGK_
LRP1 Ubiquitylation K4527 -0.315 _HSLASTDEK(gl)R_
NCL Phosphorylation S67 0.084 0.215 _VVVS(ph)PTKK_
NCL Phosphorylation T69 0.262 0.250 _KVVVSPT(ph)KK_
NCL Ubiquitylation K70 0.073 _KVVVSPTK(gl)K_
NCL Ubiquitylation K71 0.073 _KVVVSPTK(gl)K_
NCL Phosphorylation T76 -0.311 -1.653 _KVAVAT(ph)PAK_
NCL Ubiquitylation K102 0.229 _TVTPAK(gl)AVTTPGKK_
NCL Ubiquitylation K116 0.184 _GATPGK(gl)ALVATPGKK_
NCL Phosphorylation T121 -0.434 -0.594 _ALVAT(ph)PGKK_
NCL Ubiquitylation K135 0.162 _GAAIPAKGAK(gl)_
NCL Ubiquitylation K324 1.129 _SAPELK(gl)TGISDVFAK_
NCL Ubiquitylation K333 1.065 _TGISDVFAK(gl)NDLAVVDVR_
NCL Ubiquitylation K377 0.914 _VFGNEIK(gl)LEKPK_
NCL Ubiquitylation K380 1.047 _VFGNEIKLEK(gl)PK_
NCL Ubiquitylation K398 0.982 1.070 _TLLAK(gl)NLPYK_
NCL Ubiquitylation K403 1.073 _NLPYK(gl)VTQDELK_
NCL Ubiquitylation K429 1.523 _SK(gl)GIAYIEFK_
NCL Ubiquitylation K467 1.082 _SISLYYTGEK(gl)GQNQDYR_
NCL Ubiquitylation K513 1.291 -0.285 _ATFIK(gl)VPQNQNGK_
NCL Phosphorylation S563 -0.006 0.046 _LELQGPRGS(ph)PNAR_
NCL Phosphorylation S580 1.509 0.943 _GLS(ph)EDTTEETLK_
NCL Ubiquitylation K589 0.843 _GLSEDTTEETLK(gl)ESFDGSVR_
NCL Phosphorylation S619 1.522 1.942 _GFGFVDFNS(ph)EEDAK_
RAC1 Ubiquitylation K115 -1.745 -0.215 _AK(gl)WYPEVR_
RAC1 Ubiquitylation K142 0.492 _LDLRDDK(gl)DTIEK_
RAC1 Ubiquitylation K152 0.099 -0.292 _K(gl)LTPITYPQGLAMAK_
RAC1 Ubiquitylation K166 -0.981 -0.655 _LTPITYPQGLAMAK(gl)EIGAVK_
RAC1 Ubiquitylation K172 1.026 0.412 _EIGAVK(gl)YLECSALTQR_
RAC1 Ubiquitylation K185 -0.113 0.578 _GLK(gl)TVFDEAIR_
RAC1 Ubiquitylation K202 -1.379 -1.447 _AVLCPPPVK(gl)KR_
RAC1 Ubiquitylation K203 -1.708 -1.447 _AVLCPPPVKK(gl)_
SRC Phosphorylation S17 -0.604 -0.689 _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_
SRC Phosphorylation S75 0.060 0.331 _LFGGFNSSDTVTS(ph)PQR_
TGFB1 Ubiquitylation K50 -0.557 _GQILSK(gl)LR_


© Copyright Svejstrup Laboratory 2015