bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
PID_NFAT_TFPATHWAY
(Pathway_489)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
JUN 3 -0.930 0.930 -0.126
POU2F1 2 -0.480 0.830
ITCH 1 1.000 -0.610 -0.346 0.023 0.613
CREM 1 -0.880 2.870 -0.601 0.001
BATF3 1 0.160 -0.340
PRKCQ 0 0.410 0.020
NFATC2 0 -0.090 0.320
TLE4 0 -0.380 0.600 0.116
TLE4 0 -0.380 0.600
GATA3 0 0.000 -0.660
RNF128 0 -0.740 0.330
CDK4 0 1.930 -0.950
CDK4 0 1.930 -0.950 -0.510 0.013
CASP3 0 0.570 -0.390
SLC3A2 0 -0.520 0.660 0.690 1.007 -1.149 0.607 0.589
JUNB 0 0.350 -0.410
PTPN1 0 -0.150 0.310 1.066 0.459 0.251 0.322 0.379

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
BATF3 Phosphorylation S2 1.069 1.618 _(ac)S(ph)QGLPAAGSVLQR_
CASP3 Ubiquitylation K11 -0.053 -0.687 _(ac)MENTENSVDSK(gl)SIK_
CASP3 Ubiquitylation K14 -0.455 -0.687 _SIK(gl)NLEPK_
CASP3 Ubiquitylation K57 -0.304 -1.817 _NFHK(gl)STGMTSR_
CASP3 Ubiquitylation K82 -0.268 -0.605 _NLK(gl)YEVR_
CDK4 Ubiquitylation K142 -0.552 _DLK(gl)PENILVTSGGTVK_
CDK4 Ubiquitylation K211 -0.101 _K(gl)PLFCGNSEADQLGK_
CDK4 Phosphorylation S236 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK4 Phosphorylation S249 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK4 Ubiquitylation K297 0.247 0.052 _ALQHSYLHK(gl)DEGNPE_
CDK4 Phosphorylation S385 0.649 _HSSIS(ph)PVRLPLNSSLGAELSR_
CDK4 Phosphorylation S420 0.004 -0.202 _ES(ph)KGSPVFLPR_
CDK4 Phosphorylation S423 -0.155 -0.297 _GS(ph)PVFLPR_
CDK4 Phosphorylation T514 0.364 0.570 _DSKPIALKEEIVT(ph)PK_
CDK4 Phosphorylation S681 -2.532 -2.051 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK4 Phosphorylation S685 -2.729 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK4 Phosphorylation T692 -0.765 -1.849 _AIT(ph)PPQQPYK_
CDK4 Phosphorylation S1082 -1.661 -0.980 _KETTSGTSTEPVKNS(ph)SPAPPQPAPGK_
CDK4 Phosphorylation S1083 -1.093 -1.330 _NSS(ph)PAPPQPAPGK_
CDK4 Phosphorylation T1244 -0.956 _RT(ph)PTMPQEEAAACPPHILPPEK_
CREM Phosphorylation S464 0.128 _TTPSATSLPQTVVMTS(ph)PVTLTSQTTK_
CREM Ubiquitylation K481 -0.754 _TDDPQLK(gl)R_
CREM Ubiquitylation K505 0.609 0.811 _EYVK(gl)CLENR_
GATA3 Phosphorylation S162 -1.195 -0.563 _DVS(ph)PDPSLSTPGSAGSAR_
ITCH Ubiquitylation K66 -0.890 _WK(gl)QPLTVIVTPVSK_
ITCH Ubiquitylation K350 0.049 0.396 _VYYVDHVEK(gl)R_
ITCH Ubiquitylation K446 -1.514 -1.539 _EFDPLGPLPPGWEK(gl)R_
ITCH Ubiquitylation K478 -1.265 _SQGQLNEK(gl)PLPEGWEMR_
ITCH Ubiquitylation K513 -0.564 1.593 _TGK(gl)SALDNGPQIAYVR_
ITCH Ubiquitylation K861 -0.810 0.596 _VGK(gl)ENWLPR_
JUN Phosphorylation S58 -0.167 -1.247 _AKNS(ph)DLLTSPDVGLLK_
JUN Phosphorylation T62 2.545 1.674 _NSDLLT(ph)SPDVGLLK_
JUN Phosphorylation S63 2.030 1.458 _NSDLLTS(ph)PDVGLLK_
JUN Ubiquitylation K70 9.213 _NSDLLTSPDVGLLK(gl)_
JUN Phosphorylation S73 1.499 0.845 _LAS(ph)PELER_
JUN Phosphorylation S243 -0.642 -1.399 _LQALKEEPQTVPEMPGETPPLS(ph)PIDMESQER_
JUN Ubiquitylation K309 1.034 0.155 _EQVAQLK(gl)QK_
JUNB Phosphorylation T255 -0.205 _DAT(ph)PPVS(ph)PINMEDQER_
JUNB Phosphorylation S259 -0.205 _DAT(ph)PPVS(ph)PINMEDQER_
NFATC2 Phosphorylation S53 -0.845 -1.099 _VAS(ph)PPSGPAYPDDVLDYGLKPYSPLASLSGEPPGR_
NFATC2 Phosphorylation T325 -0.605 0.168 _T(ph)SPDPSPVSAAPSK_
NFATC2 Phosphorylation S326 -0.605 0.168 _T(ph)SPDPSPVSAAPSK_
POU2F1 Phosphorylation S8 1.971 2.219 _(ac)ADGGAAS(ph)QDESSAAAAAAADSR_
POU2F1 Phosphorylation S408 0.932 1.562 _RTS(ph)IETNIR_
POU2F1 Phosphorylation S471 -0.483 -0.496 _RINPPSSGGTSSS(ph)PIK_
PRKCQ Phosphorylation S685 0.911 _ALINS(ph)MDQNMFR_
PTPN1 Phosphorylation S352 0.032 _GS(ph)PLNAAPYGIESMSQDTEVR_
PTPN1 Phosphorylation S365 -0.247 0.956 _GSPLNAAPYGIESMS(ph)QDTEVR_
PTPN1 Phosphorylation S378 1.462 1.262 _VVGGS(ph)LR_
RNF128 Ubiquitylation K318 -0.039 0.167 _TCPMCK(gl)CDILK_
SLC3A2 Phosphorylation S103 0.947 _(ac)S(ph)QDTEVDMKEVELNELEPEK_
SLC3A2 Phosphorylation T106 1.017 _(ac)S(ph)QDTEVDMKEVELNELEPEKQPMNAASGAAMSLAGAEK_
SLC3A2 Ubiquitylation K145 1.389 0.982 _NGLVK(gl)IK_
SLC3A2 Ubiquitylation K147 1.147 0.705 _IK(gl)VAEDEAEAAAAAK_
SLC3A2 Ubiquitylation K160 -0.471 _VAEDEAEAAAAAK(gl)FTGLSK_
SLC3A2 Ubiquitylation K166 -0.293 0.631 _FTGLSK(gl)EELLK_
TLE4 Phosphorylation S206 0.530 _SSS(ph)VSPSASFR_
TLE4 Phosphorylation S208 0.427 0.632 _SSSVS(ph)PSASFR_
TLE4 Phosphorylation S286 0.242 0.160 _DASSS(ph)PASTASSASSTSLK_
TLE4 Phosphorylation S292 -0.214 -0.084 _DAPIS(ph)PASIASSSSTPSSK_


© Copyright Svejstrup Laboratory 2015