bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
BIOCARTA_EDG1_PATHWAY
(Pathway_216)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
PDGFA 1 0.190 -0.340 -2.109 1.885
RHOA 0 -0.510 1.370 -0.485 0.532 0.279
GNB1 0 -0.700 0.650 0.713 0.504 0.538
GNB3 0 -1.020 1.280 0.713 0.504 0.538
MAPK3 0
ASAH1 0 -0.300 0.340
PIK3CA 0
GNAI1 0 -0.580 0.990 0.116 -0.747
RAC1 0 -0.580 1.580 0.486 -0.364 -0.568
ITGAV 0 -0.297 -0.090 0.262
AKT1 0 -0.050 0.700
AKT1 0 0.860 -0.040
PIK3R1 0 1.910 -1.220 -0.441 0.147
PRKCA 0 0.750 -0.690 0.349 0.585
PRKCA 0 0.750 -0.690
PRKCB 0 0.260 -0.530
PRKCB 0 0.260 -0.530 0.349 0.585
PLCB1 0 -0.300 -0.220
SRC 0 0.050 0.470 -0.031

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
AKT1 Phosphorylation S124 0.252 0.311 _SGS(ph)PSDNSGAEEMEVSLAKPK_
AKT1 Phosphorylation S126 -0.241 _SGSPS(ph)DNSGAEEM(ox)EVSLAK_
AKT1 Ubiquitylation K301 0.988 _EGIK(gl)DGATMK_
ASAH1 Ubiquitylation K461 0.139 _ESLDVYELDAK(gl)QGR_
GNAI1 Ubiquitylation K92 0.873 0.567 _LK(gl)IDFGDSAR_
GNB1 Ubiquitylation K23 -0.282 _K(gl)ACADATLSQITNNIDPVGR_
GNB1 Ubiquitylation K209 -0.296 -0.249 _LFVSGACDASAK(gl)LWDVR_
GNB3 Ubiquitylation K23 -0.282 _K(gl)ACADATLSQITNNIDPVGR_
GNB3 Ubiquitylation K209 -0.296 -0.249 _LFVSGACDASAK(gl)LWDVR_
ITGAV Ubiquitylation K233 0.373 _YDPNVYSIK(gl)YNNQLATR_
ITGAV Ubiquitylation K360 0.294 _ASGDFQTTK(gl)LNGFEVFAR_
ITGAV Ubiquitylation K923 0.636 _GK(gl)SAILYVK_
MAPK3 Phosphorylation Y204 -0.807 -2.487 _IADPEHDHTGFLTEY(ph)VATR_
MAPK3 Ubiquitylation K289 -0.608 _NYLQSLPSKTK(gl)_
PIK3CA Ubiquitylation K864 0.390 0.588 _NSHTIM(ox)QIQCK(gl)GGLK_
PIK3CA Ubiquitylation K868 0.204 0.651 _NSHTIM(ox)QIQCKGGLK(gl)_
PIK3CA Ubiquitylation K974 -0.273 _GAQECTK(gl)TREFER_
PLCB1 Phosphorylation S1199 -0.494 _TPS(ph)SEELGGDIPGKEFDTPL_
PLCB1 Phosphorylation S1200 -0.483 _TPSS(ph)EELGGDIPGKEFDTPL_
PRKCA Phosphorylation S10 -0.650 0.036 _(ac)ADVFPGNDS(ph)TASQDVANR_
PRKCA Phosphorylation S13 -1.038 0.335 _(ac)ADVFPGNDSTAS(ph)QDVANR_
PRKCA Phosphorylation S226 0.693 0.415 _STLNPQWNES(ph)FTFK_
PRKCA Ubiquitylation K316 -0.522 -0.535 _LGPAGNK(gl)VISPSEDR_
PRKCB Phosphorylation S10 -0.650 0.036 _(ac)ADVFPGNDS(ph)TASQDVANR_
PRKCB Phosphorylation S13 -1.038 0.335 _(ac)ADVFPGNDSTAS(ph)QDVANR_
PRKCB Phosphorylation S226 0.693 0.415 _STLNPQWNES(ph)FTFK_
PRKCB Ubiquitylation K315 0.213 0.518 _ISQGTK(gl)VPEEK_
RAC1 Ubiquitylation K115 -1.745 -0.215 _AK(gl)WYPEVR_
RAC1 Ubiquitylation K142 0.492 _LDLRDDK(gl)DTIEK_
RAC1 Ubiquitylation K152 0.099 -0.292 _K(gl)LTPITYPQGLAMAK_
RAC1 Ubiquitylation K166 -0.981 -0.655 _LTPITYPQGLAMAK(gl)EIGAVK_
RAC1 Ubiquitylation K172 1.026 0.412 _EIGAVK(gl)YLECSALTQR_
RAC1 Ubiquitylation K185 -0.113 0.578 _GLK(gl)TVFDEAIR_
RAC1 Ubiquitylation K202 -1.379 -1.447 _AVLCPPPVK(gl)KR_
RAC1 Ubiquitylation K203 -1.708 -1.447 _AVLCPPPVKK(gl)_
RHOA Ubiquitylation K6 0.708 _K(gl)KLVIVGDGACGK_
RHOA Ubiquitylation K7 0.708 _K(gl)KLVIVGDGACGK_
RHOA Ubiquitylation K118 -0.408 _HFCPNVPIILVGNK(gl)K_
RHOA Ubiquitylation K119 -0.408 _HFCPNVPIILVGNK(gl)K_
RHOA Ubiquitylation K135 -0.528 -0.796 _MK(gl)QEPVKPEEGRDMANR_
RHOA Ubiquitylation K162 0.345 0.453 _IGAFGYMECSAK(gl)TK_
SRC Phosphorylation S17 -0.604 -0.689 _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_
SRC Phosphorylation S75 0.060 0.331 _LFGGFNSSDTVTS(ph)PQR_


© Copyright Svejstrup Laboratory 2015