bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
ephrin receptor binding
(GO:0046875)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
ANKS1A 2 0.920 -0.940
EPHA7 2 2.050 -0.990 0.221
EPHA7 2 2.050 -0.990
FYN 1 1.080 -1.100
FYN 1 1.080 -1.100
SIPA1L1 1 -0.260 0.030 0.397 0.037 -0.084
SIPA1L1 1 -0.260 0.030
EFNB1 0 0.450 -0.350
EFNB3 0 -0.930 0.970
SDCBP 0 -1.190 2.010 -1.188 0.299
SDCBP 0 -1.190 2.010 -0.575
TIAM1 0 -0.620 0.220
CDK5 0 -1.100 1.740 -0.236 1.063 0.312
CRK 0 -0.790 0.230
GRB2 0 -0.240 0.300 -1.021 0.057 0.906
PTPN1 0 -0.150 0.310 1.066 0.459 0.251 0.322 0.379
SRC 0 0.050 0.470 -0.031

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
ANKS1A Phosphorylation T318 -1.524 _EVDKT(ph)PPPQPPLISSMDSISQK_
ANKS1A Phosphorylation S620 1.253 1.007 _AELKLS(ph)R_
ANKS1A Phosphorylation S626 -0.415 _SLSKS(ph)DSDLLTCSPTEDATMGSR_
ANKS1A Phosphorylation S628 -0.251 _SLSKSDS(ph)DLLTCSPTEDATM(ox)GSR_
ANKS1A Phosphorylation T632 2.289 _SDSDLLT(ph)CSPTEDATM(ox)GSR_
ANKS1A Phosphorylation S634 2.127 1.474 _SDSDLLTCS(ph)PTEDATM(ox)GSR_
ANKS1A Phosphorylation S647 0.174 0.351 _SES(ph)LSNCSIGK_
ANKS1A Phosphorylation S663 0.180 0.178 _SPS(ph)FASEWDEIEK_
ANKS1A Phosphorylation S887 -0.896 _HDS(ph)LHDPAAPSR_
CDK5 Ubiquitylation K56 0.606 0.237 _EICLLK(gl)ELK_
CRK Phosphorylation S40 0.533 0.363 _DS(ph)STSPGDYVLSVSENSR_
CRK Phosphorylation S41 1.065 0.801 _DSS(ph)TSPGDYVLSVSENSR_
EFNB1 Phosphorylation S281 -0.946 0.541 _AAALS(ph)LSTLASPK_
EFNB1 Phosphorylation S283 -0.940 0.058 _AAALSLS(ph)TLASPK_
EFNB1 Phosphorylation T284 -0.851 0.002 _AAALSLS(ph)TLASPK_
EFNB3 Phosphorylation S274 0.521 _GGS(ph)LGLGGGGGMGPR_
EPHA7 Ubiquitylation K180 0.633 _EIGPLSKK(gl)_
EPHA7 Ubiquitylation K272 0.520 _AGYQQK(gl)GDTCEPCGR_
EPHA7 Ubiquitylation K578 -0.752 -0.618 _QSPEDVYFSK(gl)SEQLKPLK_
EPHA7 Ubiquitylation K583 0.445 0.124 _SEQLK(gl)PLK_
EPHA7 Ubiquitylation K606 -0.162 _FPGTK(gl)TYIDPETYEDPNR_
EPHA7 Ubiquitylation K617 0.339 _QK(gl)VIGAGEFGEVYK_
EPHA7 Ubiquitylation K634 0.732 1.340 _ELDASCIK(gl)IER_
EPHA7 Ubiquitylation K649 -1.219 _TLK(gl)AGYTEK_
EPHA7 Ubiquitylation K657 0.533 _LKLPGK(gl)R_
EPHA7 Ubiquitylation K665 3.196 _DVAVAIK(gl)TLK_
EPHA7 Ubiquitylation K797 -1.229 -0.459 _VIEDDPEAVYTTTGGK(gl)IPVR_
EPHA7 Phosphorylation S897 0.000 _LPS(ph)TSGSEGVPFR_
EPHA7 Phosphorylation T898 -0.329 0.424 _LPST(ph)SGSEGVPFR_
EPHA7 Phosphorylation S912 -0.413 _TPLGTCSRPIS(ph)PLLDQNTPDFTTFCSVGEWLQAIK_
FYN Ubiquitylation K13 0.286 _DKEATK(gl)LTEER_
FYN Phosphorylation S21 0.373 0.731 _DGS(ph)LNQSSGYR_
FYN Ubiquitylation K259 0.921 _LTDLSVK(gl)TK_
FYN Ubiquitylation K261 0.099 _LTDLSVKTK(gl)_
FYN Ubiquitylation K273 6.025 _SLCLEKK(gl)_
FYN Ubiquitylation K275 -0.521 _ESLQLIK(gl)R_
GRB2 Ubiquitylation K10 0.146 _YDFK(gl)ATADDELSFK_
GRB2 Ubiquitylation K20 -0.078 _ATADDELSFK(gl)R_
GRB2 Ubiquitylation K69 -0.362 0.641 _AK(gl)AEEMLSK_
GRB2 Ubiquitylation K76 0.754 _AEEMLSK(gl)QR_
GRB2 Ubiquitylation K109 0.381 -0.002 _FGNDVQHFK(gl)VLR_
PTPN1 Phosphorylation S352 0.032 _GS(ph)PLNAAPYGIESMSQDTEVR_
PTPN1 Phosphorylation S365 -0.247 0.956 _GSPLNAAPYGIESMS(ph)QDTEVR_
PTPN1 Phosphorylation S378 1.462 1.262 _VVGGS(ph)LR_
SDCBP Phosphorylation S6 0.120 0.427 _(ac)SLYPS(ph)LEDLKVDK_
SDCBP Ubiquitylation K35 -0.806 _(ac)SLYPSLEDLKVDK(gl)_
SDCBP Ubiquitylation K129 0.064 0.792 _RAEIK(gl)QGIR_
SDCBP Ubiquitylation K199 -0.134 -0.436 _VLK(gl)QAFGEK_
SDCBP Ubiquitylation K243 0.141 _ITSIVK(gl)DSSAAR_
SIPA1L1 Phosphorylation S161 -0.617 _FLMPEAYPS(ph)SPRK_
SIPA1L1 Phosphorylation S162 -0.151 _FLMPEAYPS(ph)SPRK_
SIPA1L1 Phosphorylation S1364 -0.112 -0.154 _EVS(ph)PAPAVAGQSK_
SIPA1L1 Phosphorylation S1433 0.276 -0.282 _HSAS(ph)PVVFTSAR_
SIPA1L1 Ubiquitylation K1515 1.582 _STIEDDLK(gl)K_
SIPA1L1 Ubiquitylation K1516 1.582 _STIEDDLK(gl)K_
SIPA1L1 Phosphorylation S1528 0.028 0.107 _DLRAS(ph)PKPTSK_
SIPA1L1 Phosphorylation S1544 0.985 1.047 _TLS(ph)DESLCSGR_
SIPA1L1 Phosphorylation S1549 0.247 -0.092 _LIDLES(ph)PTPESQK_
SIPA1L1 Phosphorylation S1585 0.556 0.584 _TLS(ph)DESIYNSQR_
SIPA1L1 Phosphorylation T1702 -0.665 _T(ph)TPTM(ox)SEEPPLDLTGK_
SIPA1L1 Phosphorylation T1703 -0.192 _TT(ph)PTMSEEPPLDLTGK_
SIPA1L1 Phosphorylation T1705 -0.178 _TTPT(ph)MSEEPPLDLTGK_
SRC Phosphorylation S17 -0.604 -0.689 _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_
SRC Phosphorylation S75 0.060 0.331 _LFGGFNSSDTVTS(ph)PQR_
TIAM1 Phosphorylation S231 0.453 0.331 _ANS(ph)LGDLYAQK_
TIAM1 Phosphorylation T1405 0.267 _T(ph)ESLPSSQQYVPFGGK_
TIAM1 Phosphorylation S1407 -0.862 -0.252 _TES(ph)LPSSQQYVPFGGK_


© Copyright Svejstrup Laboratory 2015