bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Category

Results for the Category
protein kinase inhibitor activity
(GO:0004860)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

 Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
WNK1 1 -2.390 5.600 0.546 0.639
WNK1 1 -0.180 0.010 0.546 0.639
ITPRIP 1 -1.710 2.650
MBIP 1 -0.540 0.680 -1.169
NPM1 1 1.010 -0.750 0.063 -0.066 -0.259
WNK2 0 -0.660 0.130 0.546 0.639
WNK3 0 -0.110 -0.490 0.546 0.639
DNAJC3 0 0.690 -0.440 -0.823
SH3BP5 0 0.360 -0.060
TAOK3 0 -0.440 0.370
TAOK3 0 -0.440 0.370 1.169
NCK1 0 -0.370 0.580
DUS2 0 -0.830 1.180
TRIB1 0 -0.220 -0.430
CHP1 0 0.130 0.190 -0.105 0.192
GMFB 0 -0.640 1.110

PTM Sites:

 Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
DUS2 Ubiquitylation K337 -1.649 _LSAK(gl)TSEQTGEPAEDTSGVIK_
GMFB Ubiquitylation K110 -1.081 _NK(gl)LVQTAELTK_
ITPRIP Ubiquitylation K244 -0.595 _QGYGQIK(gl)VVR_
MBIP Phosphorylation S11 1.993 _(ac)AAATEHNRPS(ph)SGDR_
MBIP Phosphorylation S12 1.993 _(ac)AAATEHNRPS(ph)SGDR_
MBIP Phosphorylation S91 0.367 0.350 _LQS(ph)PIKEENTTAVEEIGR_
NCK1 Phosphorylation S85 -0.027 -0.877 _RKPS(ph)VPDSASPADDSFVDPGER_
NCK1 Phosphorylation S91 0.493 _RKPSVPDSAS(ph)PADDSFVDPGER_
NPM1 Phosphorylation S4 -0.102 0.205 _(ac)MEDS(ph)MDMDMSPLRPQNYLFGCELK_
NPM1 Phosphorylation S10 0.493 0.606 _(ac)MEDSMDM(ox)DM(ox)S(ph)PLRPQNYLFGCELK_
NPM1 Phosphorylation Y67 0.604 0.383 _TVSLGAGAKDELHIVEAEAMNY(ph)EGSPIKVTLATLK_
NPM1 Phosphorylation S70 0.285 0.333 _TVSLGAGAKDELHIVEAEAMNYEGS(ph)PIK_
NPM1 Phosphorylation T75 0.611 0.229 _DELHIVEAEAMNYEGSPIKVT(ph)LATLK_
NPM1 Phosphorylation T78 0.397 _TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLAT(ph)LK_
NPM1 Phosphorylation S125 0.202 0.017 _CGSGPVHISGQHLVAVEEDAES(ph)EDEEEEDVK_
NPM1 Phosphorylation S139 -0.611 _LLSIS(ph)GKR_
NPM1 Ubiquitylation K141 0.568 1.699 _LLSISGK(gl)R_
NPM1 Ubiquitylation K150 -1.308 0.669 _SAPGGGSK(gl)VPQKK_
NPM1 Ubiquitylation K202 0.335 0.204 _SIRDTPAK(gl)NAQK_
NPM1 Phosphorylation S227 0.788 _SKGQES(ph)FKK_
NPM1 Phosphorylation S243 -0.070 0.063 _GPSS(ph)VEDIK_
NPM1 Ubiquitylation K248 0.294 1.847 _GPSSVEDIK(gl)AK_
NPM1 Ubiquitylation K250 0.931 1.267 _AK(gl)MQASIEK_
NPM1 Phosphorylation S254 -0.677 0.371 _MQAS(ph)IEK_
NPM1 Ubiquitylation K257 0.236 0.753 _MQASIEK(gl)GGSLPK_
NPM1 Phosphorylation S260 -0.202 0.203 _GGS(ph)LPKVEAK_
NPM1 Ubiquitylation K267 0.954 1.794 _VEAK(gl)FINYVK_
SH3BP5 Ubiquitylation K6 -0.925 _(ac)MDAALK(gl)R_
SH3BP5 Ubiquitylation K90 -1.258 _LDELVKK(gl)_
SH3BP5 Ubiquitylation K173 -0.619 _VMEAEQTK(gl)TR_
SH3BP5 Ubiquitylation K181 -1.200 _SELVHK(gl)ETAAR_
SH3BP5 Ubiquitylation K240 -0.180 _LTLAK(gl)GEYK_
TAOK3 Phosphorylation S9 -0.793 0.108 _AGS(ph)LKDPEIAELFFKEDPEK_
TAOK3 Phosphorylation S324 0.159 0.189 _NGPLNES(ph)QEDEEDSEHGTSLNR_
TAOK3 Phosphorylation S421 -0.535 -0.355 _ASDPQS(ph)PPQVSR_
TAOK3 Ubiquitylation K587 0.700 _QEWLSK(gl)QK_
TRIB1 Ubiquitylation K46 -2.031 -0.877 _LLDADDAAAVAAK(gl)CPR_
WNK1 Phosphorylation S2476 -0.727 -0.899 _KEGPVAS(ph)PPFMDLEQAVLPAVIPK_
WNK1 Phosphorylation S2503 -0.810 -0.764 _KEKPELSEPS(ph)HLNGPSSDPEAAFLSR_
WNK1 Phosphorylation S2509 -0.298 _KEKPELSEPSHLNGPS(ph)SDPEAAFLSR_
WNK1 Phosphorylation S2510 -0.532 -0.298 _KEKPELSEPSHLNGPSS(ph)DPEAAFLSR_
WNK1 Phosphorylation S2527 -0.349 _DVDDGSGS(ph)PHSPHQLSSK_
WNK1 Phosphorylation S2530 0.202 -0.225 _DVDDGSGSPHS(ph)PHQLSSK_
WNK2 Phosphorylation S2476 -0.727 -0.899 _KEGPVAS(ph)PPFMDLEQAVLPAVIPK_
WNK2 Phosphorylation S2503 -0.810 -0.764 _KEKPELSEPS(ph)HLNGPSSDPEAAFLSR_
WNK2 Phosphorylation S2509 -0.298 _KEKPELSEPSHLNGPS(ph)SDPEAAFLSR_
WNK2 Phosphorylation S2510 -0.532 -0.298 _KEKPELSEPSHLNGPSS(ph)DPEAAFLSR_
WNK2 Phosphorylation S2527 -0.349 _DVDDGSGS(ph)PHSPHQLSSK_
WNK2 Phosphorylation S2530 0.202 -0.225 _DVDDGSGSPHS(ph)PHQLSSK_
WNK3 Phosphorylation S2476 -0.727 -0.899 _KEGPVAS(ph)PPFMDLEQAVLPAVIPK_
WNK3 Phosphorylation S2503 -0.810 -0.764 _KEKPELSEPS(ph)HLNGPSSDPEAAFLSR_
WNK3 Phosphorylation S2509 -0.298 _KEKPELSEPSHLNGPS(ph)SDPEAAFLSR_
WNK3 Phosphorylation S2510 -0.532 -0.298 _KEKPELSEPSHLNGPSS(ph)DPEAAFLSR_
WNK3 Phosphorylation S2527 -0.349 _DVDDGSGS(ph)PHSPHQLSSK_
WNK3 Phosphorylation S2530 0.202 -0.225 _DVDDGSGSPHS(ph)PHQLSSK_


.

© Copyright Svejstrup Laboratory 2015