bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Category

Results for the Category
non-membrane spanning protein tyrosine kinase activity
(GO:0004715)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

 Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
FYN 1 1.080 -1.100
FYN 1 1.080 -1.100
RIPK2 1 -1.740 3.580
WEE1 1 -1.790 2.530 0.694
PEAK1 1 -0.110 0.550
LYN 1 -1.790 3.770
LYN 1 -1.790 3.770
CLK1 0 -0.740 1.390 0.612 0.032
EIF2AK2 0 -1.060 1.180 -0.657 -0.502 0.213 -0.027
ABL1 0 0.670 -0.070
PTK6 0 -0.300 0.700 0.520 0.139 1.329 0.365 0.320
CSK 0 1.200 -0.960 -1.211
CSK 0 1.200 -0.960
ABL2 0 0.050 -0.340
FER 0 0.540 -0.510 0.407
DYRK1A 0 -1.360 2.390
JAK1 0 0.190 -0.100 -1.504 -0.381 -0.438
PRKCD 0 0.250 0.070 0.578 0.427
MELK 0 -0.620 0.710 -0.249 -0.278
YES1 0 0.340 -0.470 0.295 0.576
LCK 0 -0.490 1.390 0.295 0.576
SRC 0 0.050 0.470 -0.031

PTM Sites:

 Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
ABL1 Phosphorylation S1083 -1.131 -0.857 _GQGESDPLDHEPAVS(ph)PLLPR_
ABL1 Phosphorylation S1134 0.293 _SSS(ph)FREMDGQPER_
ABL1 Phosphorylation S1232 0.821 0.183 _SCS(ph)ASCVPHGAK_
ABL2 Phosphorylation S618 -0.733 _GAQASS(ph)GSPALPR_
ABL2 Phosphorylation S620 0.568 0.091 _GAQASSGS(ph)PALPR_
ABL2 Phosphorylation S631 0.529 0.416 _DKS(ph)PSSLLEDAK_
ABL2 Phosphorylation S634 0.322 _DKSPSS(ph)LLEDAK_
ABL2 Phosphorylation S781 0.421 _S(ph)NSTSSM(ox)SSGLPEQDR_
ABL2 Phosphorylation S783 -0.171 _SNS(ph)TSSMSSGLPEQDR_
ABL2 Phosphorylation S817 0.028 0.055 _TVS(ph)TSSQPEENVDR_
ABL2 Phosphorylation S936 -0.218 -0.547 _VPVLIS(ph)PTLK_
CSK Ubiquitylation K196 -0.133 _SGWALNMKELK(gl)_
DYRK1A Ubiquitylation K11 -0.236 _(ac)MHTGGETSACK(gl)PSSVR_
DYRK1A Phosphorylation Y321 0.876 0.924 _IYQY(ph)IQSR_
EIF2AK2 Phosphorylation S83 0.256 _KAVS(ph)PLLLTTTNSSEGLSMGNYIGLINR_
FYN Ubiquitylation K13 0.286 _DKEATK(gl)LTEER_
FYN Phosphorylation S21 0.373 0.731 _DGS(ph)LNQSSGYR_
FYN Ubiquitylation K259 0.921 _LTDLSVK(gl)TK_
FYN Ubiquitylation K261 0.099 _LTDLSVKTK(gl)_
FYN Ubiquitylation K273 6.025 _SLCLEKK(gl)_
FYN Ubiquitylation K275 -0.521 _ESLQLIK(gl)R_
JAK1 Ubiquitylation K227 -0.405 _YIPETLNK(gl)SIR_
JAK1 Ubiquitylation K249 0.116 0.771 _DFLK(gl)EFNNK_
JAK1 Ubiquitylation K559 -0.478 _EISNLLVATK(gl)K_
LCK Phosphorylation T37 -0.435 _YRPENTPEPVSTSVSHYGAEPT(ph)TVSPCPSSSAK_
LCK Ubiquitylation K191 -0.112 0.264 _ESETTK(gl)GAYSLSIR_
LCK Ubiquitylation K235 0.323 _AQFDTLQK(gl)LVK_
LCK Ubiquitylation K259 -1.613 _LTTVCPTVK(gl)PQTQGLAK_
LYN Ubiquitylation K20 -0.592 _GKDSLSDDGVDLK(gl)TQPVR_
LYN Ubiquitylation K40 0.100 _DPTSNK(gl)QQRPVPESQLLPGQR_
LYN Phosphorylation S104 0.944 0.841 _DSLS(ph)DDGVDLK_
LYN Ubiquitylation K213 0.441 _HYQK(gl)QADGLCR_
LYN Ubiquitylation K477 -0.191 _VENCPDELYDIMK(gl)MCWK_
MELK Ubiquitylation K55 -0.604 _IK(gl)TEIEALK_
MELK Ubiquitylation K419 -1.760 _TPANK(gl)LK_
MELK Ubiquitylation K597 -0.858 _GYTLK(gl)CQTQSDFGK_
MELK Ubiquitylation K650 -0.307 _LVEDILSSCK(gl)V_
PEAK1 Phosphorylation S281 0.153 _ANTLS(ph)PVR_
PEAK1 Phosphorylation S568 0.247 _S(ph)APTS(ph)PTATNISSK_
PEAK1 Phosphorylation S572 0.247 _S(ph)APTS(ph)PTATNISSK_
PEAK1 Phosphorylation S823 -0.236 _SLFTS(ph)QPSGEAEAPQTTDSPTTK_
PEAK1 Phosphorylation S826 -0.505 -0.656 _SLFTSQPS(ph)GEAEAPQTTDSPTTK_
PEAK1 Phosphorylation S1036 5.225 _SHSS(ph)PSQIPK_
PRKCD Ubiquitylation K138 -0.141 _SEDEAK(gl)FPTMNR_
PRKCD Ubiquitylation K222 0.185 0.658 _DTIFQK(gl)ER_
PRKCD Phosphorylation S302 -0.240 -0.222 _S(ph)DSASSEPVGIYQGFEK_
PRKCD Phosphorylation S304 0.378 0.289 _RSDS(ph)ASSEPVGIYQGFEK_
PRKCD Phosphorylation S506 -0.213 0.200 _AS(ph)TFCGTPDYIAPEILQGLK_
PRKCD Phosphorylation T507 -0.149 0.240 _AS(ph)TFCGTPDYIAPEILQGLK_
PRKCD Ubiquitylation K641 -2.000 _DYSNFDQEFLNEK(gl)AR_
PRKCD Phosphorylation S645 0.577 0.832 _ARLS(ph)YSDK_
PRKCD Phosphorylation S647 0.886 0.853 _ARLSYS(ph)DK_
PTK6 Phosphorylation S47 0.375 0.573 _RDS(ph)LEEGELR_
PTK6 Phosphorylation T61 0.721 _MEIT(ph)IRNSPYR_
PTK6 Phosphorylation S65 0.730 0.552 _MEITIRNS(ph)PYR_
PTK6 Phosphorylation S234 -0.737 -0.712 _S(ph)PPRPPR_
PTK6 Phosphorylation S283 0.324 0.483 _DLLSDLQDIS(ph)DSER_
PTK6 Ubiquitylation K467 -0.286 _TDEIVALK(gl)R_
PTK6 Phosphorylation S589 0.529 0.585 _EYGS(ph)PLKAYT(ph)PVVVTLWYR_
PTK6 Phosphorylation T595 0.472 0.397 _AYT(ph)PVVVTLWYR_
PTK6 Ubiquitylation K672 -1.465 _IWPGYSELPAVK(gl)K_
PTK6 Ubiquitylation K673 -1.465 _IWPGYSELPAVK(gl)K_
PTK6 Ubiquitylation K719 -0.672 _ISAEDGLK(gl)HEYFR_
PTK6 Phosphorylation T751 -0.349 -0.460 _RGT(ph)SPRPPEGGLGYSQLGDDDLK_
PTK6 Phosphorylation S752 -0.526 -0.643 _RGTS(ph)PRPPEGGLGYSQLGDDDLK_
RIPK2 Ubiquitylation K410 -2.810 _AAFCDHK(gl)TTPCSSAIINPLSTAGNSER_
RIPK2 Phosphorylation S531 0.884 0.839 _SPS(ph)LNLLQNK_
RIPK2 Ubiquitylation K538 -2.659 _SPSLNLLQNK(gl)SM_
SRC Phosphorylation S17 -0.604 -0.689 _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_
SRC Phosphorylation S75 0.060 0.331 _LFGGFNSSDTVTS(ph)PQR_
WEE1 Phosphorylation S139 -0.678 -0.613 _SPAAPYFLGSSFS(ph)PVR_
YES1 Phosphorylation T37 -0.435 _YRPENTPEPVSTSVSHYGAEPT(ph)TVSPCPSSSAK_
YES1 Ubiquitylation K191 -0.112 0.264 _ESETTK(gl)GAYSLSIR_
YES1 Ubiquitylation K235 0.323 _AQFDTLQK(gl)LVK_
YES1 Ubiquitylation K259 -1.613 _LTTVCPTVK(gl)PQTQGLAK_


.

© Copyright Svejstrup Laboratory 2015