bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Category

Results for the Category
KEGG_TYPE_II_DIABETES_MELLITUS
(Pathway_97)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

 Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
INSR 2 -0.850 0.830 1.143 0.785
MAPK9 1 0.110 -0.490
PIK3R2 1 2.740 -1.180 0.269 0.348
HK1 1 0.220 -0.690 1.567 -1.654 0.693 0.567
HK1 1 0.220 -0.690 -0.135
PIK3CB 0 -1.390 2.350
PIK3CB 0 -0.710 1.450
PRKCZ 0 -0.290 0.310
MAPK3 0
IKBKB 0 0.400 0.610
PIK3R3 0 -0.140 -0.480
PIK3R3 0 -0.140 -0.480 -0.441 0.147
PIK3CA 0
IRS4 0 -0.240 -0.060 -0.868 -1.279 -1.308 -0.107 0.122
PIK3R1 0 1.910 -1.220 -0.441 0.147
HK2 0 0.400 0.360 -0.317 0.133 -0.115
HK3 0 0.440 -0.920 -0.317 0.133 -0.115
PRKCD 0 0.250 0.070 0.578 0.427
IRS1 0
IRS2 0 -0.190 -0.130
MTOR 0 -0.680 0.150 0.757 0.074 0.101

PTM Sites:

 Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
HK1 Ubiquitylation K347 0.276 _LILVK(gl)MAK_
HK1 Ubiquitylation K368 0.598 0.758 _GK(gl)FNTSDVSAIEK_
HK1 Ubiquitylation K453 -0.246 _TTVGVDGSLYK(gl)THPQYSR_
HK1 Ubiquitylation K524 0.164 0.370 _DMLLEVKK(gl)_
HK1 Ubiquitylation K798 0.769 _NILIDFTK(gl)K_
HK1 Ubiquitylation K799 0.924 _NILIDFTKK(gl)_
HK1 Ubiquitylation K920 -0.244 -0.335 _ELSPK(gl)CNVSFLLSEDGSGK_
HK2 Ubiquitylation K346 -0.340 _DISDIEGEK(gl)DGIRK_
HK2 Ubiquitylation K419 0.385 _STIGVDGSVYKK(gl)_
HK2 Ubiquitylation K451 -0.118 _SEDGSGK(gl)GAAMVTAVAYR_
HK3 Ubiquitylation K346 -0.340 _DISDIEGEK(gl)DGIRK_
HK3 Ubiquitylation K419 0.385 _STIGVDGSVYKK(gl)_
HK3 Ubiquitylation K451 -0.118 _SEDGSGK(gl)GAAMVTAVAYR_
IKBKB Ubiquitylation K106 0.253 _K(gl)YLNQFENCCGLR_
IKBKB Phosphorylation S672 0.670 0.244 _GPVSGS(ph)PDSMNASR_
INSR Ubiquitylation K1022 -0.603 _EK(gl)ITLLR_
INSR Ubiquitylation K1047 0.305 0.711 _DIIK(gl)GEAETR_
INSR Ubiquitylation K1057 0.482 0.484 _VAVK(gl)TVNESASLR_
INSR Ubiquitylation K1352 1.606 2.754 _DGGSSLGFK(gl)R_
IRS1 Phosphorylation S1101 -0.078 _HSS(ph)ETFSSTPSATR_
IRS2 Phosphorylation S308 -0.079 -0.510 _SKS(ph)QSSGSSATHPISVPGAR_
IRS2 Phosphorylation T365 0.641 0.852 _T(ph)ASEGDGGAAAGAAAAGAR_
IRS2 Phosphorylation S367 0.757 0.612 _TAS(ph)EGDGGAAAGAAAAGAR_
IRS2 Phosphorylation S393 -1.580 -1.221 _PVSVAGSPLS(ph)PGPVR_
IRS2 Phosphorylation S520 0.359 -1.006 _S(ph)NTPESIAETPPAR_
IRS2 Phosphorylation T522 -1.103 -0.770 _SNT(ph)PESIAETPPAR_
IRS2 Phosphorylation T529 0.230 0.164 _S(ph)NTPESIAET(ph)PPAR_
IRS2 Phosphorylation S562 -0.026 0.439 _RVS(ph)GDAAQDLDR_
IRS2 Phosphorylation S579 0.542 0.362 _RTYS(ph)LTTPAR_
IRS2 Phosphorylation S621 -0.190 _LCPSCPAS(ph)SPK_
IRS2 Phosphorylation S622 -0.195 _LCPSCPASS(ph)PK_
IRS2 Phosphorylation S681 0.409 _SDDYM(ox)PM(ox)S(ph)PASVSAPK_
IRS2 Phosphorylation S732 -1.089 _AS(ph)SPAESSPEDSGYM(ox)R_
IRS2 Phosphorylation S733 -1.027 0.522 _ASS(ph)PAESSPEDSGYM(ox)R_
IRS2 Phosphorylation S738 0.522 _ASS(ph)PAESS(ph)PEDSGYMR_
IRS2 Phosphorylation S917 -0.592 -1.025 _S(ph)PGEYINIDFGEPGAR_
IRS2 Phosphorylation S1164 -0.499 _HSSETFSSTTTVTPVS(ph)PSFAHNPK_
IRS2 Phosphorylation S1178 0.766 0.277 _HNSAS(ph)VENVSLR_
IRS2 Phosphorylation T1204 -0.454 _SSEGGVGVGPGGGDEPPT(ph)SPR_
IRS2 Phosphorylation S1205 -0.291 _SSEGGVGVGPGGGDEPPTS(ph)PR_
IRS4 Phosphorylation S64 -0.090 -0.062 _S(ph)DSESEEEDLPVGEEVCK_
IRS4 Phosphorylation S66 -0.354 -0.098 _SDS(ph)ESEEEDLPVGEEVCK_
IRS4 Ubiquitylation K99 -1.384 _YFVLK(gl)LETADAPAR_
IRS4 Ubiquitylation K202 -0.581 -0.941 _LILESK(gl)R_
IRS4 Ubiquitylation K240 -0.370 -0.760 _DVWQVIVK(gl)PR_
IRS4 Ubiquitylation K248 -0.351 -0.699 _K(gl)ELSGVFR_
IRS4 Phosphorylation S409 -0.928 -0.559 _FVTPSEPVAHS(ph)R_
IRS4 Phosphorylation S427 -0.406 0.053 _AVS(ph)VPASFFR_
IRS4 Phosphorylation S439 -1.003 -1.061 _RLAPS(ph)PARPR_
IRS4 Phosphorylation S457 0.337 _LS(ph)SEVSGSGSGNFGEEGNPQGK_
IRS4 Phosphorylation S458 0.236 _LSS(ph)EVSGSGSGNFGEEGNPQGK_
IRS4 Ubiquitylation K618 0.019 0.005 _SYFGK(gl)LTQSK_
IRS4 Ubiquitylation K674 -0.511 -0.585 _EVK(gl)DAEIPEGAAR_
IRS4 Phosphorylation Y743 -0.204 0.833 _GY(ph)MMMFPR_
IRS4 Phosphorylation S751 -1.810 -1.680 _VS(ph)PPPAPS(ph)PPK_
IRS4 Phosphorylation S757 -2.068 _VS(ph)PPPAPS(ph)PPK_
IRS4 Phosphorylation T764 -0.886 _APDT(ph)NKEDDSKDNDSESDYMFMAPGAGAIPK_
IRS4 Phosphorylation S775 -0.869 _APDTNKEDDSKDNDS(ph)ESDYMFMAPGAGAIPK_
IRS4 Phosphorylation S777 -0.884 -1.011 _APDTNKEDDSKDNDSES(ph)DYMFMAPGAGAIPK_
IRS4 Phosphorylation Y779 -0.702 -0.231 _APDTNKEDDSKDNDSESDY(ph)MFMAPGAGAIPK_
IRS4 Phosphorylation S804 -0.814 -0.440 _S(ph)WSSYFSLPNPFR_
IRS4 Phosphorylation S810 -1.350 _SWSSYFS(ph)LPNPFR_
IRS4 Phosphorylation S817 -1.106 -1.146 _S(ph)SPLGQNDNSEYVPM(ox)LPGK_
IRS4 Phosphorylation S818 -1.196 -1.146 _S(ph)SPLGQNDNSEYVPM(ox)LPGK_
IRS4 Phosphorylation S826 -0.663 -0.805 _SSPLGQNDNS(ph)EYVPM(ox)LPGK_
IRS4 Ubiquitylation K835 -1.658 -1.572 _SSPLGQNDNSEYVPM(ox)LPGK(gl)FLGR_
IRS4 Phosphorylation S872 -2.103 _PGDGGS(ph)PSKPSDHEPPK_
IRS4 Ubiquitylation K897 -0.308 -0.294 _LSFITK(gl)GYK_
IRS4 Phosphorylation Y921 0.195 -0.259 _EADSSSDY(ph)VNM(ox)DFTK_
IRS4 Ubiquitylation K928 -0.946 -1.115 _EADSSSDYVNMDFTK(gl)R_
IRS4 Phosphorylation S931 -0.413 -1.058 _RES(ph)NTPAPSTQGLPDSWGIIAEPR_
IRS4 Phosphorylation T933 -1.405 _RESNT(ph)PAPSTQGLPDSWGIIAEPR_
IRS4 Phosphorylation S1061 0.641 0.325 _IYVVDPFSECCM(ox)DISLS(ph)PSR_
IRS4 Phosphorylation S1091 -0.218 -0.449 _SQS(ph)FFAAAR_
IRS4 Phosphorylation S1107 -0.374 -0.244 _AAVSAFPTDS(ph)LER_
IRS4 Phosphorylation S1231 -1.675 _VPRPPEREDS(ph)DNDDDTHVR_
IRS4 Phosphorylation S1252 -0.763 _RDNQFDS(ph)PKR_
IRS4 Ubiquitylation K1254 -2.066 -1.156 _RDNQFDSPK(gl)R_
MAPK3 Phosphorylation Y204 -0.807 -2.487 _IADPEHDHTGFLTEY(ph)VATR_
MAPK3 Ubiquitylation K289 -0.608 _NYLQSLPSKTK(gl)_
MAPK9 Phosphorylation Y185 3.533 _TACTNFMMTPY(ph)VVTR_
MTOR Ubiquitylation K309 -0.762 0.065 _DLMGFGTK(gl)PR_
MTOR Ubiquitylation K1257 -1.167 -0.901 _SGQGDALASGPVETGPMKK(gl)_
MTOR Ubiquitylation K1395 -1.255 _AYAK(gl)ALHYK_
MTOR Ubiquitylation K2066 -1.004 _GPQTLK(gl)ETSFNQAYGR_
MTOR Ubiquitylation K2166 -1.304 _IQSIAPSLQVITSK(gl)QRPR_
MTOR Phosphorylation T2471 0.329 _KT(ph)GTTVPESIHSFIGDGLVKPEALNK_
PIK3CA Ubiquitylation K864 0.390 0.588 _NSHTIM(ox)QIQCK(gl)GGLK_
PIK3CA Ubiquitylation K868 0.204 0.651 _NSHTIM(ox)QIQCKGGLK(gl)_
PIK3CA Ubiquitylation K974 -0.273 _GAQECTK(gl)TREFER_
PIK3CB Ubiquitylation K1044 0.990 _SEEEALKQFKQK(gl)_
PIK3R2 Phosphorylation S262 -2.237 _APPPPS(ph)SPPPGGAPDGSEPSPDFPALLVEK_
PIK3R2 Phosphorylation S263 -2.237 _APPPPS(ph)SPPPGGAPDGSEPSPDFPALLVEK_
PIK3R2 Ubiquitylation K500 -0.189 _IFEEQGQTQEK(gl)CSK_
PIK3R2 Ubiquitylation K541 -0.609 _TK(gl)LEQQLR_
PIK3R2 Ubiquitylation K564 -0.431 -1.022 _MNSLK(gl)PDLMQLR_
PIK3R3 Ubiquitylation K226 -0.376 _YQQDQLVKEDNIDAVGKK(gl)_
PIK3R3 Ubiquitylation K320 0.385 _LGEIHDSK(gl)MR_
PRKCD Ubiquitylation K138 -0.141 _SEDEAK(gl)FPTMNR_
PRKCD Ubiquitylation K222 0.185 0.658 _DTIFQK(gl)ER_
PRKCD Phosphorylation S302 -0.240 -0.222 _S(ph)DSASSEPVGIYQGFEK_
PRKCD Phosphorylation S304 0.378 0.289 _RSDS(ph)ASSEPVGIYQGFEK_
PRKCD Phosphorylation S506 -0.213 0.200 _AS(ph)TFCGTPDYIAPEILQGLK_
PRKCD Phosphorylation T507 -0.149 0.240 _AS(ph)TFCGTPDYIAPEILQGLK_
PRKCD Ubiquitylation K641 -2.000 _DYSNFDQEFLNEK(gl)AR_
PRKCD Phosphorylation S645 0.577 0.832 _ARLS(ph)YSDK_
PRKCD Phosphorylation S647 0.886 0.853 _ARLSYS(ph)DK_
PRKCZ Phosphorylation T560 -0.884 -1.578 _KQALPPFQPQITDDYGLDNFDTQFTSEPVQLT(ph)PDDEDAIKR_


.

© Copyright Svejstrup Laboratory 2015