bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
BIOCARTA_SPPA_PATHWAY
(Pathway_680)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
RAF1 1 2.020 -1.230
MAP2K1 1 -1.590 2.780
GNB1 0 -0.700 0.650 0.713 0.504 0.538
GNB3 0 -1.020 1.280 0.713 0.504 0.538
MAPK3 0
GNAI1 0 -0.580 0.990 0.116 -0.747
ITGB1 0 0.390 -0.650 0.101 -0.036
PRKCA 0 0.750 -0.690 0.349 0.585
PRKCA 0 0.750 -0.690
PRKCB 0 0.260 -0.530
PRKCB 0 0.260 -0.530 0.349 0.585
HRAS 0 1.470 -0.520
F2R 0 0.220 0.110
PLCB1 0 -0.300 -0.220
SRC 0 0.050 0.470 -0.031
ITGA1 0 -0.750 1.480 0.650 0.069

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
F2R Ubiquitylation K421 0.836 0.568 _MDTCSSNLNNSIYK(gl)K_
GNAI1 Ubiquitylation K92 0.873 0.567 _LK(gl)IDFGDSAR_
GNB1 Ubiquitylation K23 -0.282 _K(gl)ACADATLSQITNNIDPVGR_
GNB1 Ubiquitylation K209 -0.296 -0.249 _LFVSGACDASAK(gl)LWDVR_
GNB3 Ubiquitylation K23 -0.282 _K(gl)ACADATLSQITNNIDPVGR_
GNB3 Ubiquitylation K209 -0.296 -0.249 _LFVSGACDASAK(gl)LWDVR_
HRAS Ubiquitylation K170 -1.005 _K(gl)LNPPDESGPGCMSCK_
ITGB1 Ubiquitylation K774 0.402 _MNAK(gl)WDTGENPIYK_
ITGB1 Ubiquitylation K784 -0.172 0.350 _WDTGENPIYK(gl)SAVTTVVNPK_
ITGB1 Ubiquitylation K794 0.755 0.604 _SAVTTVVNPK(gl)YEGK_
MAP2K1 Ubiquitylation K192 -0.205 -0.241 _DVK(gl)PSNILVNSR_
MAP2K1 Phosphorylation S385 0.066 _RSDAEEVDFAGWLCSTIGLNQPS(ph)TPTHAAGV_
MAP2K1 Phosphorylation T386 0.377 _RSDAEEVDFAGWLCSTIGLNQPST(ph)PTHAAGV_
MAPK3 Phosphorylation Y204 -0.807 -2.487 _IADPEHDHTGFLTEY(ph)VATR_
MAPK3 Ubiquitylation K289 -0.608 _NYLQSLPSKTK(gl)_
PLCB1 Phosphorylation S1199 -0.494 _TPS(ph)SEELGGDIPGKEFDTPL_
PLCB1 Phosphorylation S1200 -0.483 _TPSS(ph)EELGGDIPGKEFDTPL_
PRKCA Phosphorylation S10 -0.650 0.036 _(ac)ADVFPGNDS(ph)TASQDVANR_
PRKCA Phosphorylation S13 -1.038 0.335 _(ac)ADVFPGNDSTAS(ph)QDVANR_
PRKCA Phosphorylation S226 0.693 0.415 _STLNPQWNES(ph)FTFK_
PRKCA Ubiquitylation K316 -0.522 -0.535 _LGPAGNK(gl)VISPSEDR_
PRKCB Phosphorylation S10 -0.650 0.036 _(ac)ADVFPGNDS(ph)TASQDVANR_
PRKCB Phosphorylation S13 -1.038 0.335 _(ac)ADVFPGNDSTAS(ph)QDVANR_
PRKCB Phosphorylation S226 0.693 0.415 _STLNPQWNES(ph)FTFK_
PRKCB Ubiquitylation K315 0.213 0.518 _ISQGTK(gl)VPEEK_
RAF1 Phosphorylation S29 0.028 -0.571 _DAVFDGSSCIS(ph)PTIVQQFGYQR_
RAF1 Phosphorylation T31 0.028 -0.669 _DAVFDGSSCIS(ph)PTIVQQFGYQR_
RAF1 Phosphorylation S244 0.053 _YSTPHAFTFNTSS(ph)PSSEGSLSQR_
RAF1 Phosphorylation S259 -0.069 0.054 _STS(ph)TPNVHM(ox)VSTTLPVDSR_
RAF1 Phosphorylation S301 -0.651 _SHSESASPSALSSSPNNLS(ph)PTGWSQPK_
RAF1 Phosphorylation T303 -0.664 _SHSESASPSALSSSPNNLSPT(ph)GWSQPK_
RAF1 Phosphorylation S497 -0.449 _SRWS(ph)GSQQVEQPTGSVLWMAPEVIR_
RAF1 Phosphorylation S621 0.212 0.271 _SAS(ph)EPSLHR_
RAF1 Phosphorylation S642 -0.197 0.463 _AAHTEDINACTLTTS(ph)PR_
SRC Phosphorylation S17 -0.604 -0.689 _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_
SRC Phosphorylation S75 0.060 0.331 _LFGGFNSSDTVTS(ph)PQR_


© Copyright Svejstrup Laboratory 2015