bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
BIOCARTA_ERK_PATHWAY
(Pathway_1072)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
RAF1 1 2.020 -1.230
IGF1R 1 -0.490 0.750 1.476 0.714
MAP2K1 1 -1.590 2.780
GNB1 0 -0.700 0.650 0.713 0.504 0.538
GNB3 0 -1.020 1.280 0.713 0.504 0.538
GNAS 0 0.840 -0.750
GNAS 0 0.840 -0.750
GNAS 0 0.840 -0.750 -0.166 -0.094 0.032 0.420 0.504
MAPK3 0
PPP2CA 0 0.160 -0.540 0.194 0.044 0.215
PPP2CA 0 0.160 -0.540 0.650 1.189
SOS1 0 0.500 -0.620 -0.570
RPS6KA1 0 -0.160 -0.660
RPS6KA1 0 -0.160 -0.660
ELK1 0
MAP2K2 0 -0.610 0.080
MAP2K2 0 -0.610 0.080
MYC 0 0.170 0.550 -2.443 -0.949 -0.454 -1.290
EGFR 0 -0.580 0.520 0.513 0.090
ITGB1 0 0.390 -0.650 0.101 -0.036
PTPRR 0 -1.270 1.640 -0.083
STAT3 0 0.200 -1.270 0.334
HRAS 0 1.470 -0.520
GRB2 0 -0.240 0.300 -1.021 0.057 0.906
SRC 0 0.050 0.470 -0.031

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
EGFR Phosphorylation T693 0.486 -0.139 _ELVEPLT(ph)PSGEAPNQALLR_
EGFR Phosphorylation S991 -0.041 _MHLPS(ph)PTDSNFYR_
ELK1 Phosphorylation S273 -0.601 -0.553 _PAVVLPSAAPAGAAAPPS(ph)GSR_
ELK1 Phosphorylation S275 -0.601 -0.553 _PAVVLPSAAPAGAAAPPS(ph)GSR_
ELK1 Phosphorylation S403 0.568 -0.579 _DLELPLS(ph)PSLLGGPGPER_
GNAS Ubiquitylation K8 0.430 0.328 _GCLGNSK(gl)TEDQRNEEK(gl)AQR_
GNAS Ubiquitylation K17 -0.011 _GCLGNSK(gl)TEDQRNEEK(gl)AQR_
GNAS Ubiquitylation K32 0.249 -0.446 _QLQK(gl)DKQVYR_
GNAS Ubiquitylation K58 -1.182 0.161 _STIVK(gl)QM(ox)R_
GNAS Ubiquitylation K92 -1.333 -0.290 _ATK(gl)VQDIKNNLK_
GNAS Ubiquitylation K97 0.076 _VQDIK(gl)NNLK_
GNAS Ubiquitylation K167 -1.721 _LHALK(gl)LR_
GNAS Ubiquitylation K301 -0.955 -0.198 _QDLLAEK(gl)VLAGK_
GNAS Ubiquitylation K308 -0.472 _SK(gl)IEDYFPEFAR_
GNB1 Ubiquitylation K23 -0.282 _K(gl)ACADATLSQITNNIDPVGR_
GNB1 Ubiquitylation K209 -0.296 -0.249 _LFVSGACDASAK(gl)LWDVR_
GNB3 Ubiquitylation K23 -0.282 _K(gl)ACADATLSQITNNIDPVGR_
GNB3 Ubiquitylation K209 -0.296 -0.249 _LFVSGACDASAK(gl)LWDVR_
GRB2 Ubiquitylation K10 0.146 _YDFK(gl)ATADDELSFK_
GRB2 Ubiquitylation K20 -0.078 _ATADDELSFK(gl)R_
GRB2 Ubiquitylation K69 -0.362 0.641 _AK(gl)AEEMLSK_
GRB2 Ubiquitylation K76 0.754 _AEEMLSK(gl)QR_
GRB2 Ubiquitylation K109 0.381 -0.002 _FGNDVQHFK(gl)VLR_
HRAS Ubiquitylation K170 -1.005 _K(gl)LNPPDESGPGCMSCK_
IGF1R Ubiquitylation K47 1.146 _NDYQQLK(gl)R_
IGF1R Ubiquitylation K1033 5.779 _VAIK(gl)TVNEAASMR_
IGF1R Ubiquitylation K1168 0.191 _K(gl)GGKGLLPVR_
IGF1R Ubiquitylation K1171 0.232 _GGK(gl)GLLPVR_
ITGB1 Ubiquitylation K774 0.402 _MNAK(gl)WDTGENPIYK_
ITGB1 Ubiquitylation K784 -0.172 0.350 _WDTGENPIYK(gl)SAVTTVVNPK_
ITGB1 Ubiquitylation K794 0.755 0.604 _SAVTTVVNPK(gl)YEGK_
MAP2K1 Ubiquitylation K192 -0.205 -0.241 _DVK(gl)PSNILVNSR_
MAP2K1 Phosphorylation S385 0.066 _RSDAEEVDFAGWLCSTIGLNQPS(ph)TPTHAAGV_
MAP2K1 Phosphorylation T386 0.377 _RSDAEEVDFAGWLCSTIGLNQPST(ph)PTHAAGV_
MAP2K2 Phosphorylation S23 0.873 0.258 _RKPVLPALTINPTIAEGPS(ph)PTSEGASEANLVDLQK_
MAP2K2 Phosphorylation T25 0.439 _RKPVLPALTINPTIAEGPSPT(ph)SEGASEANLVDLQK_
MAP2K2 Ubiquitylation K192 -0.205 -0.241 _DVK(gl)PSNILVNSR_
MAP2K2 Phosphorylation S293 -0.361 _ELEAIFGRPVVDGEEGEPHS(ph)ISPR_
MAP2K2 Phosphorylation S295 -0.234 0.026 _ELEAIFGRPVVDGEEGEPHSIS(ph)PR_
MAP2K2 Phosphorylation T394 0.570 0.158 _LNQPGT(ph)PTR_
MAPK3 Phosphorylation Y204 -0.807 -2.487 _IADPEHDHTGFLTEY(ph)VATR_
MAPK3 Ubiquitylation K289 -0.608 _NYLQSLPSKTK(gl)_
MYC Phosphorylation S20 -1.444 -1.145 _PLNVS(ph)FTNR_
MYC Phosphorylation T72 -1.699 -1.813 _FELLPT(ph)PPLS(ph)PSRR_
MYC Phosphorylation S76 -1.777 -1.435 _FELLPTPPLS(ph)PSR_
MYC Phosphorylation S81 0.459 _S(ph)GLCSPSYVAVTPFSLR_
MYC Phosphorylation S85 0.199 0.073 _SGLCS(ph)PSYVAVTPFSLR_
MYC Ubiquitylation K162 -2.475 -1.259 _LVSEK(gl)LASYQAAR_
MYC Phosphorylation S295 -0.903 _SESGS(ph)PSAGGHSKPPHSPLVLK_
MYC Phosphorylation S307 -1.486 _SES(ph)GSPSAGGHSKPPHS(ph)PLVLK_
MYC Ubiquitylation K340 -2.449 _VK(gl)LDSVR_
MYC Ubiquitylation K403 -3.432 _DQIPELENNEK(gl)APK_
PPP2CA Ubiquitylation K4 -0.788 -0.378 _(ac)MDDK(gl)AFTK_
PPP2CA Ubiquitylation K4 -0.450 -0.016 _(ac)M(ox)DEK(gl)VFTK_
PPP2CA Ubiquitylation K8 -0.522 _VFTK(gl)ELDQWIEQLNECK_
PPP2CA Ubiquitylation K21 -1.370 _ELDQWVEQLNECK(gl)QLNENQVR_
PPP2CA Ubiquitylation K21 -1.106 _ELDQWIEQLNECK(gl)QLSESQVK_
PPP2CA Ubiquitylation K29 0.211 0.122 _QLSESQVK(gl)SLCEK_
PPP2CA Ubiquitylation K36 -0.455 0.187 _AK(gl)EILTK_
PPP2CA Ubiquitylation K36 -0.455 0.187 _AK(gl)EILTK_
PPP2CA Ubiquitylation K41 -0.049 0.003 _EILTK(gl)ESNVQEVR_
PPP2CA Ubiquitylation K74 -0.316 -0.316 _IGGK(gl)SPDTNYLFMGDYVDR_
RAF1 Phosphorylation S29 0.028 -0.571 _DAVFDGSSCIS(ph)PTIVQQFGYQR_
RAF1 Phosphorylation T31 0.028 -0.669 _DAVFDGSSCIS(ph)PTIVQQFGYQR_
RAF1 Phosphorylation S244 0.053 _YSTPHAFTFNTSS(ph)PSSEGSLSQR_
RAF1 Phosphorylation S259 -0.069 0.054 _STS(ph)TPNVHM(ox)VSTTLPVDSR_
RAF1 Phosphorylation S301 -0.651 _SHSESASPSALSSSPNNLS(ph)PTGWSQPK_
RAF1 Phosphorylation T303 -0.664 _SHSESASPSALSSSPNNLSPT(ph)GWSQPK_
RAF1 Phosphorylation S497 -0.449 _SRWS(ph)GSQQVEQPTGSVLWMAPEVIR_
RAF1 Phosphorylation S621 0.212 0.271 _SAS(ph)EPSLHR_
RAF1 Phosphorylation S642 -0.197 0.463 _AAHTEDINACTLTTS(ph)PR_
RPS6KA1 Phosphorylation S227 0.363 0.496 _AYS(ph)FCGTVEYM(ox)APEVVNR_
RPS6KA1 Phosphorylation T231 0.315 _KAYSFCGT(ph)VEYMAPEVVNR_
RPS6KA1 Ubiquitylation K316 -1.156 _LGSGPDGAEEIK(gl)R_
RPS6KA1 Phosphorylation T359 -0.149 -0.339 _T(ph)PKDSPGIPPSAGAHQLFR_
RPS6KA1 Phosphorylation S363 -0.711 -0.697 _TPKDS(ph)PGIPPSAGAHQLFR_
RPS6KA1 Ubiquitylation K566 -0.152 _ICDFGFAK(gl)QLR_
SOS1 Phosphorylation S1082 0.278 _IPESETESTASAPNS(ph)PR_
SOS1 Phosphorylation S1166 0.097 -0.094 _RPESAPAES(ph)SPSK_
SRC Phosphorylation S17 -0.604 -0.689 _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_
SRC Phosphorylation S75 0.060 0.331 _LFGGFNSSDTVTS(ph)PQR_
STAT3 Ubiquitylation K177 0.957 _VVENLQDDFDFNYK(gl)TLK_
STAT3 Ubiquitylation K180 1.179 _TLK(gl)SQGDMQDLNGNNQSVTR_
STAT3 Ubiquitylation K244 0.262 _TLTDEELADWK(gl)R_
STAT3 Phosphorylation T714 -0.338 _FICVT(ph)PTTCSNTIDLPMS(ph)PR_
STAT3 Phosphorylation S727 -0.079 0.156 _FICVTPTTCSNTIDLPMS(ph)PR_


© Copyright Svejstrup Laboratory 2015