bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Category

Results for the Category
positive regulation of nuclear-transcribed mRNA poly(A) tail shortening
(GO:0060213)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

 Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
AGO2 1 0.370 -0.620 0.303 -0.277 -0.950 0.328
ZFP36 1 -1.860 3.010
PABPC1 0 0.100 -0.400 0.167 -0.387 -0.147 -0.312 -0.037
TNRC6C 0 -0.980 1.140
TNRC6B 0 -1.680 2.330
CNOT1 0 0.579 -0.249 -0.264 -0.019
TOB1 0 1.290 -1.000
CNOT7 0 0.480 -0.730 -0.386
CNOT7 0 0.480 -0.730

PTM Sites:

 Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
AGO2 Ubiquitylation K381 0.665 _SAPDRQEEISK(gl)LMR_
AGO2 Phosphorylation S387 -0.656 _SAS(ph)FNTDPYVR_
AGO2 Ubiquitylation K550 0.445 1.991 _VGDTVLGMATQCVQMK(gl)NVQR_
AGO2 Ubiquitylation K720 -1.047 0.670 _LFCTDK(gl)NER_
AGO2 Ubiquitylation K726 0.458 0.936 _VGK(gl)SGNIPAGTTVDTK_
CNOT1 Phosphorylation S1061 0.555 0.326 _TVTVTRPTGVS(ph)FKK_
CNOT1 Ubiquitylation K1064 -0.495 _TVTVTRPTGVSFKK(gl)_
CNOT1 Ubiquitylation K1708 0.686 _AYGSPWCNK(gl)QITR_
CNOT1 Ubiquitylation K2185 -0.010 0.228 _DLDSYLK(gl)TR_
CNOT7 Ubiquitylation K200 -1.098 -0.157 _YLMK(gl)SCK_
PABPC1 Ubiquitylation K78 -0.883 0.807 _ALDTMNFDVIK(gl)GKPVR_
PABPC1 Ubiquitylation K95 -0.105 0.553 _K(gl)SGVGNIFIK_
PABPC1 Ubiquitylation K104 -0.977 -0.336 _SGVGNIFIK(gl)NLDK_
PABPC1 Ubiquitylation K108 -0.071 0.530 _NLDK(gl)SIDNK_
PABPC1 Ubiquitylation K138 -0.960 _VVCDENGSK(gl)GYGFVHFETQEAAER_
PABPC1 Ubiquitylation K157 -0.582 _AIEK(gl)MNGMLLNDRK_
PABPC1 Ubiquitylation K188 -0.826 -0.017 _AK(gl)EFTNVYIK_
PABPC1 Ubiquitylation K213 -0.170 _DLFGK(gl)FGPALSVK_
PABPC1 Ubiquitylation K231 0.080 _SK(gl)GFGFVSFER_
PABPC1 Ubiquitylation K259 -0.125 _ELNGK(gl)QIYVGR_
PABPC1 Ubiquitylation K279 -0.143 0.326 _K(gl)FEQMK(gl)QDR_
PABPC1 Ubiquitylation K284 -0.108 0.322 _K(gl)FEQMK(gl)QDR_
PABPC1 Ubiquitylation K312 0.122 _K(gl)EFSPFGTITSAK_
PABPC1 Ubiquitylation K361 -0.142 _IVATK(gl)PLYVALAQR_
PABPC1 Ubiquitylation K512 -0.640 0.085 _TVPQYK(gl)YAAGVR_
TNRC6B Phosphorylation S1432 -1.203 -0.920 _GGS(ph)PYNQFDIIPGDTLGGHTGPAGDSWLPAK_
TNRC6B Phosphorylation S1461 -0.788 -0.865 _GGSPYNQFDIIPGDTLGGHTGPAGDSWLPAKS(ph)PPTNK_
TNRC6B Phosphorylation T1464 -0.696 _GGSPYNQFDIIPGDTLGGHTGPAGDSWLPAKSPPT(ph)NK_
TNRC6B Phosphorylation S1512 0.304 _GIQNIDPESDPYVTPGSVLGGTATS(ph)PIVDTDHQLLR_
TNRC6C Phosphorylation S714 -0.816 -0.786 _DSSEATGWEEPS(ph)PPSIR_
TOB1 Phosphorylation T204 -0.200 0.244 _T(ph)SPINLGLNVNDLLK_
TOB1 Phosphorylation S205 -0.200 0.244 _T(ph)SPINLGLNVNDLLK_
ZFP36 Phosphorylation S93 -0.357 _LGPELSPSPTS(ph)PTATSTTPSR_
ZFP36 Phosphorylation T95 -0.633 -0.624 _LGPELSPSPTSPT(ph)ATSTTPSR_


.

© Copyright Svejstrup Laboratory 2015