bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: TNRC6B

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
TNRC6B 0 1.846 -1.680 2.330

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
TNRC6B Phosphorylation S1512 0.304 _GIQNIDPESDPYVTPGSVLGGTATS(ph)PIVDTDHQLLR_
TNRC6B Phosphorylation T1464 -0.696 _GGSPYNQFDIIPGDTLGGHTGPAGDSWLPAKSPPT(ph)NK_
TNRC6B Phosphorylation S1461 -0.788 -0.865 _GGSPYNQFDIIPGDTLGGHTGPAGDSWLPAKS(ph)PPTNK_
TNRC6B Phosphorylation S1432 -1.203 -0.920 _GGS(ph)PYNQFDIIPGDTLGGHTGPAGDSWLPAK_

Background Information for TNRC6B:


Pubmed-TNRC6B »
Uniprot-TNRC6B »
Biogrid-TNRC6B »
ProteomicsDB-TNRC6B »

Tumorportal-TNRC6B »
COSMIC-TNRC6B »
GenomeRNAi-TNRC6B »
Genecards-TNRC6B


Protein-protein Interactions for TNRC6B
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait CLTC Cat. description Hein, Mann, Cell 2015
Category members IP bait EIF2C3 Cat. description Hein, Mann, Cell 2015
Category members IP bait GTSE1 Cat. description Hein, Mann, Cell 2015
Category members IP bait KAT6A Cat. description Hein, Mann, Cell 2015
Category members IP bait RNASEH2B Cat. description Hein, Mann, Cell 2015
Category members IP bait SHOC2 Cat. description Hein, Mann, Cell 2015


Protein Domains in TNRC6B
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members UBA-like IPR009060 0.17
Category members Argonaute_hook_dom IPR019486 0


Protein complexes (CORUM database) featuring TNRC6B
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring TNRC6B
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0003723 RNA binding Database INF
Category members GO Category GO:0005515 protein binding Database INF
Category members GO Category GO:0005829 cytosol Database INF
Category members GO Category GO:0010467 gene expression Database INF
Category members GO Category GO:0000166 nucleotide binding Database 5.91
Category members GO Category GO:0048015 phosphatidylinositol-mediated signaling Database 0.98
Category members GO Category GO:0048011 neurotrophin TRK receptor signaling pathway Database 0.63
Category members GO Category GO:0038095 Fc-epsilon receptor signaling pathway Database 0.36
Category members Pathway Pathway_117 REACTOME_SIGNALING_BY_NOTCH 0 0.33
Category members GO Category GO:0008543 fibroblast growth factor receptor signaling pathway Database 0.29
Category members GO Category GO:0007173 epidermal growth factor receptor signaling pathway Database 0.26
Category members Pathway Pathway_891 REACTOME_PRE_NOTCH_TRANSCRIPTION_AND_TRANSLATION 0 0.24
Category members Pathway Pathway_379 REACTOME_REGULATORY_RNA_PATHWAYS 0 0.12
Category members Pathway Pathway_113 REACTOME_PRE_NOTCH_EXPRESSION_AND_PROCESSING 0 0.08
Category members GO Category GO:0000932 cytoplasmic mRNA processing body Database 0.08
Category members GO Category GO:0045087 innate immune response Database 0.05
Category members GO Category GO:0007219 Notch signaling pathway Database 0.05
Category members GO Category GO:0006417 regulation of translation Database 0
Category members GO Category GO:0031047 gene silencing by RNA Database 0
Category members GO Category GO:0060213 positive regulation of nuclear-transcribed mRNA poly(A) tail shortening Database 0


.

© Copyright Svejstrup Laboratory 2015