bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Category

Results for the Category
phosphoprotein binding
(GO:0051219)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

 Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
THRAP3 3 1.430 -0.880 0.813 -0.969 0.662 0.407 0.317
FKBP4 2 0.540 -0.110 0.084 0.155 0.235
PAFAH1B1 1 0.820 -0.330 1.632 0.711
TOX3 1 -0.410 0.180 -0.273 1.371 1.804 -2.005 0.037
BAG1 1
YWHAE 1 0.440 -0.380 1.095 -0.160
YWHAE 1 0.440 -0.380 1.129 0.621 0.321
CSNK1G1 1 -1.760 3.030 -0.583 0.273
IGF2R 1 2.250 -1.150 -0.107 0.125
LYN 1 -1.790 3.770
LYN 1 -1.790 3.770
DPYSL3 0 0.400 -0.420 -0.511
CSNK1G2 0 -0.520 0.560 -0.583 0.273
ARRB1 0 0.960 -0.620
RB1 0 1.180 -1.070 0.429 0.755
RB1 0 1.180 -1.070
CSNK1D 0 0.340 -0.060 0.150 0.527
CSNK1D 0 0.340 -0.060
CSNK1D 0 0.340 -0.060 1.237 -0.682 -0.148
CBX4 0 0.230 0.160 0.798 0.323
RRAGA 0 -0.490 0.890 0.176
YWHAB 0 0.628 -0.543
YWHAB 0 0.507 0.271 0.503
GPRIN1 0 -0.960 1.040
SFN 0 0.890 0.120 -4.300
GRB2 0 -0.240 0.300 -1.021 0.057 0.906
SRC 0 0.050 0.470 -0.031
MTOR 0 -0.680 0.150 0.757 0.074 0.101

PTM Sites:

 Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
ARRB1 Phosphorylation S412 0.138 0.253 _GMKDDKEEEEDGTGS(ph)PQLNNR_
BAG1 Phosphorylation S119 2.802 _S(ph)QEVTRDEESTR_
BAG1 Ubiquitylation K273 -0.087 0.605 _DLQAEALCK(gl)LDRR_
CBX4 Phosphorylation S291 0.263 0.125 _SGEVAEGEARS(ph)PSHKK_
CBX4 Phosphorylation S293 0.227 _SGEVAEGEARSPS(ph)HKK_
CSNK1D Ubiquitylation K43 -1.168 _LECVK(gl)TK_
CSNK1D Ubiquitylation K45 -1.168 _LECVK(gl)TK_
CSNK1D Ubiquitylation K140 -0.969 _DVKPDNFLMGLGK(gl)K_
CSNK1D Ubiquitylation K141 -0.969 -0.720 _DVKPDNFLMGLGKK(gl)_
CSNK1D Phosphorylation S350 -0.790 _LRGTQEVAPPTPLTPTS(ph)HTANTSPRPVSGM(ox)ER_
CSNK1D Phosphorylation S363 -0.662 -0.352 _IQPAGNTS(ph)PR_
CSNK1D Phosphorylation S382 -0.647 -0.568 _GAPVNIS(ph)SSDLTGR_
CSNK1D Phosphorylation S389 0.394 0.817 _GAPANVS(ph)SSDLTGR_
CSNK1G1 Ubiquitylation K48 -0.536 _K(gl)IGCGNFGELR_
CSNK1G1 Ubiquitylation K198 -0.394 _EYIDPETK(gl)K_
CSNK1G1 Ubiquitylation K199 -0.394 _EYIDPETK(gl)K_
CSNK1G1 Ubiquitylation K253 0.276 0.386 _GSLPWQGLK(gl)ADTLK_
CSNK1G2 Ubiquitylation K48 -0.536 _K(gl)IGCGNFGELR_
CSNK1G2 Ubiquitylation K198 -0.394 _EYIDPETK(gl)K_
CSNK1G2 Ubiquitylation K199 -0.394 _EYIDPETK(gl)K_
CSNK1G2 Ubiquitylation K253 0.276 0.386 _GSLPWQGLK(gl)ADTLK_
DPYSL3 Phosphorylation S102 -1.104 -0.731 _EESREPAPAS(ph)PAPAGVEIR_
DPYSL3 Phosphorylation T622 -0.228 _GM(ox)YDGPVFDLTT(ph)TPK_
DPYSL3 Phosphorylation T623 -0.604 -0.464 _GM(ox)YDGPVFDLTTT(ph)PK_
DPYSL3 Phosphorylation S636 -0.777 -0.696 _GS(ph)PTRPNPPVR_
FKBP4 Ubiquitylation K28 -1.537 _ATESGAQSAPLPMEGVDISPK(gl)QDEGVLK_
FKBP4 Ubiquitylation K282 1.052 1.457 _GTVYFK(gl)EGK_
FKBP4 Ubiquitylation K354 1.353 _ALELDSNNEK(gl)GLFR_
FKBP4 Ubiquitylation K387 -0.016 _VLQLYPNNK(gl)AAK_
FKBP4 Ubiquitylation K390 1.528 2.262 _AAK(gl)TQLAVCQQR_
FKBP4 Ubiquitylation K409 0.591 _K(gl)LYANMFER_
FKBP4 Ubiquitylation K441 -0.410 _AEASSGDHPTDTEMK(gl)EEQK_
GPRIN1 Phosphorylation S73 0.009 _HRS(ph)PSGAGEGASCSDGPR_
GPRIN1 Phosphorylation S75 -0.815 0.112 _SPS(ph)GAGEGASCSDGPR_
GPRIN1 Phosphorylation S452 0.423 0.603 _AGTVS(ph)PGKEDPVSSR_
GPRIN1 Phosphorylation S615 -0.210 -0.043 _VGSLPLEKGS(ph)PVTTTK_
GPRIN1 Phosphorylation S734 -0.027 _ALGS(ph)ARSPEGAR_
GPRIN1 Phosphorylation S737 0.351 0.226 _ALGSARS(ph)PEGAR_
GRB2 Ubiquitylation K10 0.146 _YDFK(gl)ATADDELSFK_
GRB2 Ubiquitylation K20 -0.078 _ATADDELSFK(gl)R_
GRB2 Ubiquitylation K69 -0.362 0.641 _AK(gl)AEEMLSK_
GRB2 Ubiquitylation K76 0.754 _AEEMLSK(gl)QR_
GRB2 Ubiquitylation K109 0.381 -0.002 _FGNDVQHFK(gl)VLR_
IGF2R Ubiquitylation K2352 -0.372 0.420 _SSNVSYK(gl)YSK_
IGF2R Ubiquitylation K2394 -0.020 0.221 _EGQENGHITTK(gl)SVK_
IGF2R Phosphorylation S2409 0.107 0.119 _ALSSLHGDDQDS(ph)EDEVLTIPEVK_
LYN Ubiquitylation K20 -0.592 _GKDSLSDDGVDLK(gl)TQPVR_
LYN Ubiquitylation K40 0.100 _DPTSNK(gl)QQRPVPESQLLPGQR_
LYN Phosphorylation S104 0.944 0.841 _DSLS(ph)DDGVDLK_
LYN Ubiquitylation K213 0.441 _HYQK(gl)QADGLCR_
LYN Ubiquitylation K477 -0.191 _VENCPDELYDIMK(gl)MCWK_
MTOR Ubiquitylation K309 -0.762 0.065 _DLMGFGTK(gl)PR_
MTOR Ubiquitylation K1257 -1.167 -0.901 _SGQGDALASGPVETGPMKK(gl)_
MTOR Ubiquitylation K1395 -1.255 _AYAK(gl)ALHYK_
MTOR Ubiquitylation K2066 -1.004 _GPQTLK(gl)ETSFNQAYGR_
MTOR Ubiquitylation K2166 -1.304 _IQSIAPSLQVITSK(gl)QRPR_
MTOR Phosphorylation T2471 0.329 _KT(ph)GTTVPESIHSFIGDGLVKPEALNK_
PAFAH1B1 Ubiquitylation K76 -0.530 _LNEAK(gl)EEFTSGGPLGQK_
RB1 Phosphorylation S69 -3.602 -3.397 _TAATAAAAAAEPPAPPPPPPPEEDPEQDS(ph)GPEDLPLVR_
RB1 Ubiquitylation K97 -0.546 _LK(gl)IPDHVR_
RB1 Phosphorylation T388 0.005 0.116 _TLQTDSIDSFETQRT(ph)PR_
RB1 Phosphorylation T405 -0.851 -0.901 _KSNLDEEVNVIPPHT(ph)PVR_
RB1 Phosphorylation S820 -0.019 _S(ph)PYKFPSSPLR_
RB1 Ubiquitylation K823 -2.214 _SPYK(gl)FPSSPLR_
RB1 Phosphorylation S827 0.824 0.111 _FPSS(ph)PLR_
RB1 Phosphorylation S839 -0.701 -1.045 _IPGGNIYIS(ph)PLKS(ph)PYK_
RB1 Ubiquitylation K842 -0.751 _IPGGNIYISPLK(gl)SPYK_
RB1 Phosphorylation S843 -0.701 -0.022 _IPGGNIYIS(ph)PLKS(ph)PYK_
RB1 Ubiquitylation K846 -2.084 _SPYK(gl)ISEGLPTPTK_
RB1 Phosphorylation T853 0.039 -0.555 _ISEGLPT(ph)PTKM(ox)T(ph)PR_
RB1 Ubiquitylation K856 -1.350 _ISEGLPTPTK(gl)MTPR_
RB1 Phosphorylation T858 -0.782 0.564 _ISEGLPT(ph)PTKMT(ph)PR_
RB1 Ubiquitylation K879 -0.187 _FQK(gl)INQMVCNSDR_
RRAGA Ubiquitylation K307 0.056 0.970 _VDGPK(gl)HSLLMR_
SFN Ubiquitylation K11 0.561 0.388 _AK(gl)LAEQAER_
SFN Ubiquitylation K49 -0.093 0.337 _NLLSVAYK(gl)_
SRC Phosphorylation S17 -0.604 -0.689 _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_
SRC Phosphorylation S75 0.060 0.331 _LFGGFNSSDTVTS(ph)PQR_
THRAP3 Phosphorylation S184 0.079 0.248 _SSS(ph)KDSRPSQAAGDNQGDEAK_
THRAP3 Phosphorylation T210 3.824 _EQTFSGGT(ph)SQDTK_
THRAP3 Phosphorylation S211 3.487 3.148 _EQTFSGGTS(ph)QDTK_
THRAP3 Phosphorylation S232 -0.501 -0.585 _ASESSKPWPDATYGTGS(ph)ASR_
THRAP3 Phosphorylation S243 0.422 0.427 _ASAVSELS(ph)PR_
THRAP3 Phosphorylation S248 0.461 0.278 _ERS(ph)PALKSPLQSVVVR_
THRAP3 Phosphorylation S253 0.721 1.235 _SPALKS(ph)PLQSVVVR_
THRAP3 Phosphorylation S315 0.541 _KS(ph)PVGKS(ph)PPSTGSTYGSSQK_
THRAP3 Phosphorylation S320 -0.234 -0.545 _KSPVGKS(ph)PPSTGSTYGSSQK_
THRAP3 Phosphorylation S377 2.629 2.451 _IKEKGS(ph)FSDTGLGDGK_
THRAP3 Phosphorylation S379 0.975 1.024 _GSFS(ph)DTGLGDGK_
THRAP3 Phosphorylation S575 1.245 0.792 _MDS(ph)FDEDLARPSGLLAQER_
THRAP3 Phosphorylation S672 0.274 0.190 _NKKS(ph)PEIHR_
THRAP3 Phosphorylation S682 0.380 0.508 _IDIS(ph)PSTFR_
THRAP3 Phosphorylation S684 0.619 0.637 _RIDISPS(ph)TFRK_
THRAP3 Phosphorylation T874 -1.185 -1.519 _NREEEWDPEYT(ph)PK_
THRAP3 Phosphorylation S928 0.752 0.713 _WAHDKFS(ph)GEEGEIEDDESGTENR_
THRAP3 Phosphorylation S939 0.345 0.471 _FSGEEGEIEDDES(ph)GTENR_
THRAP3 Phosphorylation T953 -0.085 _FSGEEGEIEDDESGTENREEKDNIQPT(ph)TE_
TOX3 Phosphorylation T175 0.465 _LST(ph)TPSPTSSLHEDGVEDFRR_
TOX3 Phosphorylation S178 0.750 0.447 _LSTTPS(ph)PTSSLHEDGVEDFRR_
TOX3 Ubiquitylation K494 -3.056 _INLQQQPPPLQIK(gl)SVPLPTLK_
YWHAB Ubiquitylation K11 1.057 1.322 _(ac)TMDKSELVQK(gl)AK_
YWHAB Ubiquitylation K13 0.060 0.388 _AK(gl)LAEQAER_
YWHAB Ubiquitylation K70 0.558 -0.175 _VISSIEQK(gl)TER_
YWHAB Ubiquitylation K140 0.531 _YLSEVASGDNK(gl)QTTVSNSQQAYQEAFEISKK_
YWHAB Ubiquitylation K159 0.300 _QTTVSNSQQAYQEAFEISK(gl)K_
YWHAB Ubiquitylation K160 -0.439 -0.371 _K(gl)EMQPTHPIR_
YWHAE Ubiquitylation K38 0.710 1.822 _YDEMVESMK(gl)K_
YWHAE Ubiquitylation K39 1.734 _YDEMVESMKK(gl)_
YWHAE Ubiquitylation K60 0.554 1.732 _NLLSVAYK(gl)NVIGAR_
YWHAE Ubiquitylation K83 0.375 0.643 _IISSIEQKEENK(gl)GGEDKLK_
YWHAE Ubiquitylation K90 1.103 _GGEDKLK(gl)MIR_
YWHAE Ubiquitylation K116 -0.289 _LICCDILDVLDK(gl)HLIPAANTGESK_
YWHAE Ubiquitylation K133 0.653 1.264 _VFYYK(gl)M(ox)K_
YWHAE Ubiquitylation K152 0.031 0.601 _K(gl)EAAENSLVAYK_
YWHAE Phosphorylation S210 0.534 0.506 _AAFDDAIAELDTLS(ph)EESYK_
YWHAE Phosphorylation S213 0.541 _AAFDDAIAELDTLSEES(ph)YK_


.

© Copyright Svejstrup Laboratory 2015