bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
establishment of cell polarity
(GO:0030010)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
MARK2 2 0.390 -0.570 -0.342 -0.924
GSK3B 2 1.020 -0.870 -1.128 1.091
MYO9B 2 0.820 -0.550
RAB11FIP2 1 -1.860 2.780
ARHGEF11 1 -1.250 1.080
IGF1R 1 -0.490 0.750 1.476 0.714
WEE1 1 -1.790 2.530 0.694
CFL1 1 0.725 0.148 -0.943
SDCCAG8 0 0.350 -0.490
PRKCZ 0 -0.290 0.310
STK11 0
MPP7 0 0.640 -0.320 1.118 0.576
EPHB1 0 -0.220 0.000 0.221
EPHB1 0 -0.220 0.000 -0.042
EPHB1 0 -0.220 0.000
BRSK1 0 0.330 -0.040
JAM3 0 0.860 -0.200 0.644 0.464
BRSK2 0 1.070 -0.640

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
ARHGEF11 Phosphorylation S216 1.512 _LSLDS(ph)QEGDSGLDSGTER_
ARHGEF11 Phosphorylation S556 0.780 0.048 _SSSQSTFHIPLS(ph)PVEVKPGNVR_
ARHGEF11 Phosphorylation T668 -1.878 _SLENPT(ph)PPFT(ph)PK_
ARHGEF11 Phosphorylation S1155 -0.647 -0.776 _HQVLLEDPEQEGS(ph)AEEEELGVLPCPSTSLDGENR_
ARHGEF11 Phosphorylation T1292 0.389 0.509 _T(ph)RNSGIWESPELDR_
ARHGEF11 Phosphorylation S1295 0.556 0.668 _TRNS(ph)GIWESPELDR_
ARHGEF11 Phosphorylation S1458 1.017 2.592 _SLGGESS(ph)GGTTPVGSFHTEAAR_
ARHGEF11 Phosphorylation S1480 -0.293 _WTDGSLS(ph)PPAKEPLASDSR_
BRSK1 Phosphorylation S489 -0.354 -0.198 _NSFLGS(ph)PR_
BRSK2 Phosphorylation S294 0.075 _SLPS(ph)LEDIDPDVLDSMHSLGCFR_
BRSK2 Phosphorylation S382 0.812 -1.070 _S(ph)MEVLSVTDGGSPVPAR_
BRSK2 Phosphorylation S393 -0.463 -1.217 _S(ph)M(ox)EVLSVTDGGS(ph)PVPAR_
BRSK2 Phosphorylation S423 -0.553 -0.633 _SISGASSGLSTS(ph)PLSSPR_
BRSK2 Phosphorylation S489 -0.354 -0.198 _NSFLGS(ph)PR_
CFL1 Phosphorylation S41 0.781 0.338 _(ac)AS(ph)GVAVSDGVIK_
CFL1 Ubiquitylation K57 0.538 0.318 _VFNDMK(gl)VR_
CFL1 Ubiquitylation K82 1.563 _AVLFCLSEDK(gl)K_
CFL1 Ubiquitylation K83 1.163 _AVLFCLSEDKK(gl)_
CFL1 Ubiquitylation K116 0.583 _MLPDK(gl)DCR_
CFL1 Ubiquitylation K130 0.398 0.825 _YALYDATYETK(gl)ESK_
CFL1 Ubiquitylation K133 0.441 _YALYDATYETKESK(gl)_
CFL1 Ubiquitylation K152 0.783 0.508 _SK(gl)MIYASSK_
CFL1 Ubiquitylation K159 0.778 0.532 _MIYASSK(gl)DAIK_
CFL1 Ubiquitylation K182 -0.079 0.077 _HELQANCYEEVK(gl)DR_
EPHB1 Ubiquitylation K578 -0.752 -0.618 _QSPEDVYFSK(gl)SEQLKPLK_
EPHB1 Ubiquitylation K583 0.445 0.124 _SEQLK(gl)PLK_
EPHB1 Ubiquitylation K617 0.339 _QK(gl)VIGAGEFGEVYK_
EPHB1 Ubiquitylation K649 -1.219 _TLK(gl)AGYTEK_
EPHB1 Ubiquitylation K657 0.533 _LKLPGK(gl)R_
EPHB1 Phosphorylation S897 0.000 _LPS(ph)TSGSEGVPFR_
EPHB1 Phosphorylation T898 -0.329 0.424 _LPST(ph)SGSEGVPFR_
GSK3B Phosphorylation S9 -0.483 0.010 _TTS(ph)FAESCKPVQQPSAFGSMK_
GSK3B Ubiquitylation K85 -0.204 _LCDSGELVAIK(gl)K_
GSK3B Ubiquitylation K86 -0.204 _LCDSGELVAIK(gl)K_
GSK3B Phosphorylation S215 0.296 0.477 _GEPNVS(ph)YICSR_
GSK3B Phosphorylation Y216 0.356 0.376 _GEPNVSY(ph)ICSR_
GSK3B Phosphorylation T390 2.800 2.527 _IQAAAST(ph)PTNATAASDANTGDR_
IGF1R Ubiquitylation K47 1.146 _NDYQQLK(gl)R_
IGF1R Ubiquitylation K1033 5.779 _VAIK(gl)TVNEAASMR_
IGF1R Ubiquitylation K1168 0.191 _K(gl)GGKGLLPVR_
IGF1R Ubiquitylation K1171 0.232 _GGK(gl)GLLPVR_
MARK2 Phosphorylation S387 3.794 _PSADLTNSS(ph)APSPSHK_
MARK2 Phosphorylation S390 5.149 4.932 _PSADLTNSSAPS(ph)PSHK_
MARK2 Phosphorylation S456 -1.253 -1.182 _VPAS(ph)PLPGLER_
MARK2 Phosphorylation S486 -0.028 0.163 _SRNS(ph)PLLER_
MARK2 Phosphorylation S569 -0.860 -0.742 _VPVAS(ph)PSAHNISSSGGAPDR_
MARK2 Phosphorylation S571 -0.724 _VPVASPS(ph)AHNISSSGGAPDR_
MYO9B Phosphorylation S717 0.375 _AAGMSS(ph)PGAQSHPEELPR_
MYO9B Phosphorylation S1261 -1.739 -2.057 _VS(ph)PPAPGSAPETPEDK_
MYO9B Phosphorylation S1267 -0.114 -0.387 _VSPPAPGS(ph)APET(ph)PEDK_
MYO9B Phosphorylation T1271 -0.114 -0.387 _VSPPAPGS(ph)APET(ph)PEDK_
MYO9B Phosphorylation S1290 0.761 0.703 _VQEKPDS(ph)PGGSTQIQR_
MYO9B Phosphorylation S1354 0.955 0.892 _RTS(ph)FSTSDVSK_
MYO9B Phosphorylation S1405 1.890 1.745 _KKPGDASSLPDAGLS(ph)PGSQVDSK_
MYO9B Phosphorylation S1992 -0.221 0.324 _GS(ph)DEENLDSETSASTESLLEER_
PRKCZ Phosphorylation T560 -0.884 -1.578 _KQALPPFQPQITDDYGLDNFDTQFTSEPVQLT(ph)PDDEDAIKR_
RAB11FIP2 Phosphorylation S429 0.165 _ASNIMPSSSFHMSPTS(ph)NEDLR_
SDCCAG8 Phosphorylation S4 1.097 1.380 _(ac)AKS(ph)PENSTLEEILGQYQR_
STK11 Phosphorylation S31 0.437 0.073 _IDS(ph)TEVIYQPR_
STK11 Phosphorylation T32 1.256 0.248 _IDS(ph)TEVIYQPR_
WEE1 Phosphorylation S139 -0.678 -0.613 _SPAAPYFLGSSFS(ph)PVR_


© Copyright Svejstrup Laboratory 2015