bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
SAP complex (Sin3-associated protein complex)
(591)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
ARID4B 1 -0.520 0.690 0.971 -0.275 0.174 -0.031 -0.144
HDAC1 1 -1.980 4.450
HDAC1 1 -1.980 4.450 -0.122 0.307 0.969 0.094 0.191
RBBP4 1 2.110 -1.240 0.533 -0.610 0.648
HDAC2 1 -2.390 4.970
HDAC2 1 -2.390 4.970 0.187 -0.007 0.825
RBBP7 0 -0.080 -0.020 0.602 0.336 0.890 0.363 0.402
RBBP7 0 -0.080 -0.020 0.397 0.000 0.776
RBBP7 0 -0.080 -0.020
SAP130 0 -0.270 0.400 -0.526 -0.067 -0.348 0.543 0.182
SAP30 0 -0.180 0.110 -0.538 0.864
SIN3A 0 -0.610 0.780 0.378 -0.208 0.304 -0.168 0.410

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
ARID4B Phosphorylation S675 -0.335 -0.381 _LSKPPFQTNPS(ph)PEMVSK_
ARID4B Phosphorylation S790 0.615 _DIEVLS(ph)EDTDYEEDEVTK_
ARID4B Phosphorylation S1153 1.670 _GTNSS(ph)DSEELSAGESITK_
HDAC1 Ubiquitylation K50 0.036 _K(gl)MEIYRPHK_
HDAC1 Ubiquitylation K66 -0.593 _ANAEEMTK(gl)YHSDDYIK_
HDAC1 Ubiquitylation K74 0.620 -1.473 _YHSDDYIK(gl)FLR_
HDAC1 Ubiquitylation K89 0.749 -0.241 _SIRPDNMSEYSK(gl)QMQR_
HDAC1 Phosphorylation S393 -1.133 -1.144 _M(ox)LPHAPGVQM(ox)QAIPEDAIPEES(ph)GDEDEDDPDKR_
HDAC1 Phosphorylation S409 1.326 1.144 _ISICS(ph)SDKR_
HDAC1 Phosphorylation S410 1.326 1.144 _ISICS(ph)SDKR_
HDAC1 Ubiquitylation K412 0.642 -0.744 _ISICSSDK(gl)R_
HDAC2 Ubiquitylation K50 0.036 _K(gl)MEIYRPHK_
HDAC2 Ubiquitylation K67 -0.467 _ATAEEMTK(gl)YHSDEYIK_
HDAC2 Ubiquitylation K89 0.749 -0.241 _SIRPDNMSEYSK(gl)QMQR_
HDAC2 Ubiquitylation K284 0.749 _GHAK(gl)CVEVVK_
HDAC2 Phosphorylation S394 -0.865 -0.997 _M(ox)LPHAPGVQM(ox)QAIPEDAVHEDS(ph)GDEDGEDPDKR_
HDAC2 Phosphorylation S422 0.482 0.781 _IACDEEFS(ph)DSEDEGEGGR_
RBBP4 Ubiquitylation K4 0.699 0.574 _(ac)ADK(gl)EAAFDDAVEER_
RBBP4 Ubiquitylation K160 -1.765 _HPSK(gl)PDPSGECNPDLR_
RBBP7 Phosphorylation S3 1.036 1.447 _(ac)AS(ph)KEMFEDTVEER_
RBBP7 Ubiquitylation K4 0.122 -0.804 _(ac)ASK(gl)EMFEDTVEER_
RBBP7 Ubiquitylation K21 0.081 -0.004 _VINEEYK(gl)IWK_
RBBP7 Phosphorylation S145 0.319 1.248 _TPS(ph)SDVLVFDYTK_
RBBP7 Ubiquitylation K159 -1.249 -3.808 _HPAK(gl)PDPSGECNPDLR_
RBBP7 Ubiquitylation K214 -0.021 _EGK(gl)IVDAK_
RBBP7 Ubiquitylation K236 0.469 _DSSVK(gl)LYQTR_
SAP130 Phosphorylation S416 1.220 0.951 _VVPQQITHTS(ph)PR_
SAP30 Ubiquitylation K214 -0.201 -0.160 _SDLK(gl)VDSGVH_
SIN3A Ubiquitylation K155 0.182 _EFK(gl)SQSIDTPGVISR_
SIN3A Phosphorylation T266 -0.572 _VSKPSQLQAHTPASQQT(ph)PPLPPYASPR_
SIN3A Phosphorylation S277 -1.598 _S(ph)PPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNK_
SIN3A Phosphorylation S295 -1.959 _SPPVQPHTPVTISLGTAPS(ph)LQNNQPVEFNHAINYVNK_
SIN3A Ubiquitylation K638 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K639 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K715 1.012 _GFNK(gl)VWR_
SIN3A Phosphorylation S832 0.764 0.363 _GDLS(ph)DVEEEEEEEM(ox)DVDEATGAVKK_
SIN3A Ubiquitylation K875 0.131 0.003 _LLFSNTAAQK(gl)LR_
SIN3A Ubiquitylation K937 -0.224 -0.025 _DK(gl)SDSPAIQLR_
SIN3A Phosphorylation S940 -0.107 _DKSDS(ph)PAIQLR_
SIN3A Phosphorylation T1111 0.691 0.517 _YM(ox)NSDTT(ph)SPELR_
SIN3A Phosphorylation S1112 0.623 0.725 _YM(ox)NSDTTS(ph)PELR_


© Copyright Svejstrup Laboratory 2015