bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
REACTOME_CTLA4_INHIBITORY_SIGNALING
(Pathway_936)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
AKT3 2 0.580 -0.030 -0.194
AKT3 2 0.580 -0.030
FYN 1 1.080 -1.100
FYN 1 1.080 -1.100
PPP2CB 1 2.210 -0.980 0.194 0.044 0.215
PPP2CB 1 2.210 -0.980 0.650 1.189
PPP2R1A 1 -0.260 -0.200 0.714 0.973
PPP2R1A 1 -0.260 -0.200 -0.003 -0.196 0.057
PPP2R1A 1 -0.260 -0.200 1.697 1.450 -1.553
PPP2R1B 1 1.240 -0.730 1.697 1.450 -1.553
PPP2R5D 1 -0.110 0.620
PPP2R5D 1 -0.110 0.620 -0.455 -0.019
PPP2R5E 1 -2.260 4.450
LYN 1 -1.790 3.770
LYN 1 -1.790 3.770
PPP2R5A 0 -0.210 0.930
PPP2R5C 0 0.790 -0.490
PPP2R5C 0 0.790 -0.490 -0.455 -0.019
AKT2 0 -1.420 2.210 -0.194
PPP2CA 0 0.160 -0.540 0.194 0.044 0.215
PPP2CA 0 0.160 -0.540 0.650 1.189
PDPK1 0 0.050 -0.440
AKT1 0 -0.050 0.700
AKT1 0 0.860 -0.040
YES1 0 0.340 -0.470 0.295 0.576
LCK 0 -0.490 1.390 0.295 0.576
SRC 0 0.050 0.470 -0.031

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
AKT1 Phosphorylation S124 0.252 0.311 _SGS(ph)PSDNSGAEEMEVSLAKPK_
AKT1 Phosphorylation S126 -0.241 _SGSPS(ph)DNSGAEEM(ox)EVSLAK_
AKT1 Ubiquitylation K301 0.988 _EGIK(gl)DGATMK_
AKT2 Ubiquitylation K14 0.306 0.070 _EGWLHK(gl)R_
AKT2 Ubiquitylation K111 1.082 _AIQMVANSLK(gl)QR_
AKT2 Ubiquitylation K160 0.251 _LLGK(gl)GTFGK_
AKT2 Phosphorylation T451 -0.091 -0.612 _YFDDEFTAQSITIT(ph)PPDRYDSLGLLELDQR_
AKT2 Phosphorylation Y456 -0.265 _YFDDEFTAQSITITPPDRY(ph)DSLGLLELDQR_
AKT3 Ubiquitylation K14 0.306 0.070 _EGWLHK(gl)R_
AKT3 Ubiquitylation K14 4.941 5.277 _EGWVQK(gl)R_
AKT3 Ubiquitylation K111 1.082 _AIQMVANSLK(gl)QR_
AKT3 Phosphorylation S120 1.097 _MNCS(ph)PTSQIDNIGEEEMDASTTHHK_
AKT3 Ubiquitylation K160 0.251 _LLGK(gl)GTFGK_
AKT3 Phosphorylation T451 -0.091 -0.612 _YFDDEFTAQSITIT(ph)PPDRYDSLGLLELDQR_
AKT3 Phosphorylation Y456 -0.265 _YFDDEFTAQSITITPPDRY(ph)DSLGLLELDQR_
FYN Ubiquitylation K13 0.286 _DKEATK(gl)LTEER_
FYN Phosphorylation S21 0.373 0.731 _DGS(ph)LNQSSGYR_
FYN Ubiquitylation K259 0.921 _LTDLSVK(gl)TK_
FYN Ubiquitylation K261 0.099 _LTDLSVKTK(gl)_
FYN Ubiquitylation K273 6.025 _SLCLEKK(gl)_
FYN Ubiquitylation K275 -0.521 _ESLQLIK(gl)R_
LCK Phosphorylation T37 -0.435 _YRPENTPEPVSTSVSHYGAEPT(ph)TVSPCPSSSAK_
LCK Ubiquitylation K191 -0.112 0.264 _ESETTK(gl)GAYSLSIR_
LCK Ubiquitylation K235 0.323 _AQFDTLQK(gl)LVK_
LCK Ubiquitylation K259 -1.613 _LTTVCPTVK(gl)PQTQGLAK_
LYN Ubiquitylation K20 -0.592 _GKDSLSDDGVDLK(gl)TQPVR_
LYN Ubiquitylation K40 0.100 _DPTSNK(gl)QQRPVPESQLLPGQR_
LYN Phosphorylation S104 0.944 0.841 _DSLS(ph)DDGVDLK_
LYN Ubiquitylation K213 0.441 _HYQK(gl)QADGLCR_
LYN Ubiquitylation K477 -0.191 _VENCPDELYDIMK(gl)MCWK_
PDPK1 Phosphorylation S241 0.358 0.361 _ANS(ph)FVGTAQYVSPELLTEK_
PDPK1 Ubiquitylation K257 0.571 -0.234 _ANSFVGTAQYVSPELLTEK(gl)SACK_
PPP2CA Ubiquitylation K4 -0.788 -0.378 _(ac)MDDK(gl)AFTK_
PPP2CA Ubiquitylation K4 -0.450 -0.016 _(ac)M(ox)DEK(gl)VFTK_
PPP2CA Ubiquitylation K8 -0.522 _VFTK(gl)ELDQWIEQLNECK_
PPP2CA Ubiquitylation K21 -1.370 _ELDQWVEQLNECK(gl)QLNENQVR_
PPP2CA Ubiquitylation K21 -1.106 _ELDQWIEQLNECK(gl)QLSESQVK_
PPP2CA Ubiquitylation K29 0.211 0.122 _QLSESQVK(gl)SLCEK_
PPP2CA Ubiquitylation K36 -0.455 0.187 _AK(gl)EILTK_
PPP2CA Ubiquitylation K36 -0.455 0.187 _AK(gl)EILTK_
PPP2CA Ubiquitylation K41 -0.049 0.003 _EILTK(gl)ESNVQEVR_
PPP2CA Ubiquitylation K74 -0.316 -0.316 _IGGK(gl)SPDTNYLFMGDYVDR_
PPP2CB Ubiquitylation K4 -0.788 -0.378 _(ac)MDDK(gl)AFTK_
PPP2CB Ubiquitylation K4 -0.450 -0.016 _(ac)M(ox)DEK(gl)VFTK_
PPP2CB Ubiquitylation K8 -0.522 _VFTK(gl)ELDQWIEQLNECK_
PPP2CB Ubiquitylation K21 -1.370 _ELDQWVEQLNECK(gl)QLNENQVR_
PPP2CB Ubiquitylation K21 -1.106 _ELDQWIEQLNECK(gl)QLSESQVK_
PPP2CB Ubiquitylation K29 0.211 0.122 _QLSESQVK(gl)SLCEK_
PPP2CB Ubiquitylation K36 -0.455 0.187 _AK(gl)EILTK_
PPP2CB Ubiquitylation K36 -0.455 0.187 _AK(gl)EILTK_
PPP2CB Ubiquitylation K41 -0.049 0.003 _EILTK(gl)ESNVQEVR_
PPP2CB Ubiquitylation K74 -0.316 -0.316 _IGGK(gl)SPDTNYLFMGDYVDR_
PPP2R1A Ubiquitylation K34 0.304 _K(gl)LSTIALALGVER_
PPP2R1A Ubiquitylation K107 0.584 0.441 _DK(gl)AVESLR_
PPP2R1A Ubiquitylation K163 0.106 0.149 _VSSAVK(gl)AELR_
PPP2R1A Ubiquitylation K175 -0.351 _ASNAVK(gl)AEIR_
PPP2R1A Ubiquitylation K188 0.395 0.130 _AAASK(gl)LGEFAK_
PPP2R1A Ubiquitylation K255 0.301 0.202 _QAAEDK(gl)SWR_
PPP2R1A Ubiquitylation K266 0.464 0.338 _YMVADK(gl)FTELQK_
PPP2R1A Ubiquitylation K284 -0.575 _FSELQK(gl)AMGPK_
PPP2R1A Ubiquitylation K307 0.224 0.500 _VK(gl)EFCENLSADCR_
PPP2R1A Ubiquitylation K467 0.890 _EAATSNLK(gl)K_
PPP2R1A Ubiquitylation K468 0.890 _EAATSNLK(gl)K_
PPP2R1A Ubiquitylation K542 -0.187 _FNVAK(gl)SLQK_
PPP2R1B Ubiquitylation K175 -0.351 _ASNAVK(gl)AEIR_
PPP2R1B Ubiquitylation K284 -0.575 _FSELQK(gl)AMGPK_
PPP2R5A Phosphorylation S5 -0.414 _(ac)SSSS(ph)PPAGAASAAISASEK_
PPP2R5C Ubiquitylation K232 -0.302 _FLESPDFQPNIAK(gl)K_
PPP2R5C Ubiquitylation K233 -0.302 0.665 _FLESPDFQPNIAKK(gl)_
PPP2R5C Ubiquitylation K409 -0.010 _QLAK(gl)CVSSPHFQVAER_
PPP2R5D Phosphorylation T63 -1.449 _RPSNST(ph)PPPTQLSK_
PPP2R5D Ubiquitylation K232 -0.302 _FLESPDFQPNIAK(gl)K_
PPP2R5D Ubiquitylation K233 -0.302 0.665 _FLESPDFQPNIAKK(gl)_
PPP2R5D Ubiquitylation K409 -0.010 _QLAK(gl)CVSSPHFQVAER_
PPP2R5D Phosphorylation S573 0.524 0.357 _RKS(ph)ELPQDVYTIK_
PPP2R5D Phosphorylation S598 -0.317 1.858 _RAEEFLTAS(ph)QEAL_
PPP2R5E Phosphorylation T73 -0.181 0.065 _(ac)SSAPTT(ph)PPSVDKVDGFSR_
PPP2R5E Ubiquitylation K412 0.197 _IQEPLFK(gl)QIAK_
SRC Phosphorylation S17 -0.604 -0.689 _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_
SRC Phosphorylation S75 0.060 0.331 _LFGGFNSSDTVTS(ph)PQR_
YES1 Phosphorylation T37 -0.435 _YRPENTPEPVSTSVSHYGAEPT(ph)TVSPCPSSSAK_
YES1 Ubiquitylation K191 -0.112 0.264 _ESETTK(gl)GAYSLSIR_
YES1 Ubiquitylation K235 0.323 _AQFDTLQK(gl)LVK_
YES1 Ubiquitylation K259 -1.613 _LTTVCPTVK(gl)PQTQGLAK_


© Copyright Svejstrup Laboratory 2015