bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
negative regulation of protein ubiquitination
(GO:0031397)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
N4BP1 1 -1.890 2.620
N4BP1 1 -0.940 0.710
ARRB2 1 2.000 -1.160 -0.340 0.096 0.051 -1.604
UFL1 0 1.140 -1.070 0.912 0.837
CAV1 0 1.150 -0.150
CAV1 0 1.150 -0.150
CAV1 0 1.150 -0.150
GTPBP4 0 -1.150 1.590 -0.623 -0.725
GTPBP4 0 -1.150 1.590 -0.486 0.142
TNFAIP3 0 0.760 -0.500
SOX4 0 1.610 -0.930
ARRB1 0 0.960 -0.620
UBXN1 0 0.810 -0.820 -0.696
CDK5 0 -1.100 1.740 -0.236 1.063 0.312
GLMN 0 1.160 -1.250 0.000
PRMT3 0 0.110 -0.060 -1.110 0.427
CHP1 0 0.130 0.190 -0.105 0.192

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
ARRB1 Phosphorylation S412 0.138 0.253 _GMKDDKEEEEDGTGS(ph)PQLNNR_
ARRB2 Ubiquitylation K199 -1.933 _VQFAPEK(gl)PGPQPSAETTR_
CAV1 Ubiquitylation K5 0.591 0.963 _(ac)SGGK(gl)YVDSEGHLYTVPIR_
CAV1 Phosphorylation S6 0.836 0.688 _(ac)ADELS(ph)EKQVYDAHTK_
CAV1 Ubiquitylation K8 0.244 0.734 _(ac)ADELSEK(gl)QVYDAHTK_
CAV1 Ubiquitylation K26 0.724 0.894 _EQGNIYK(gl)PNNK_
CAV1 Ubiquitylation K30 -0.008 0.317 _EQGNIYKPNNK(gl)AMADELSEK_
CAV1 Ubiquitylation K39 0.690 1.170 _AMADELSEK(gl)QVYDAHTK_
CAV1 Phosphorylation S76 0.607 0.527 _AMADELS(ph)EK_
CAV1 Ubiquitylation K176 -0.259 _INLQK(gl)EI_
CDK5 Ubiquitylation K56 0.606 0.237 _EICLLK(gl)ELK_
GLMN Ubiquitylation K11 0.194 _(ac)AVEELQSIIK(gl)R_
GLMN Ubiquitylation K214 0.595 _FCFK(gl)SLK_
GLMN Ubiquitylation K433 0.331 _NQIDMSLK(gl)R_
GLMN Ubiquitylation K525 -0.081 _AHYEAEIK(gl)NSQEAQK_
GTPBP4 Ubiquitylation K187 0.585 _SSFINK(gl)VTR_
N4BP1 Phosphorylation T242 0.090 0.086 _AGT(ph)PVSELTK_
N4BP1 Phosphorylation S300 0.738 1.001 _KQFS(ph)LENVQEGEILHDAK_
N4BP1 Ubiquitylation K412 0.502 _NK(gl)GVYSSTNELTTDSTPK_
SOX4 Phosphorylation S354 -0.003 _SSAASSPAAGRS(ph)PADHR_
TNFAIP3 Ubiquitylation K722 0.496 0.176 _ASCK(gl)NILACR_
UBXN1 Ubiquitylation K83 -1.791 _EPTSSEQGGLEGSGSAAGEGK(gl)PALSEEER_
UBXN1 Ubiquitylation K96 -1.483 _EPTSSEQGGLEGSGSAAGEGKPALSEEERQEQTK(gl)R_
UBXN1 Ubiquitylation K105 0.343 0.709 _RM(ox)LELVAQK(gl)QR_
UBXN1 Ubiquitylation K154 1.029 0.790 _EK(gl)AEELAAR_
UBXN1 Ubiquitylation K178 -4.185 _K(gl)YGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR_
UBXN1 Phosphorylation S200 -1.255 -2.127 _KYGGSVGSQPPPVAPEPGPVPSS(ph)PSQEPPTKR_


© Copyright Svejstrup Laboratory 2015