bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: UBXN1

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
UBXN1 0 -2.259 0.810 -0.820 -0.696

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
UBXN1 Ubiquitylation K154 1.029 0.790 _EK(gl)AEELAAR_
UBXN1 Ubiquitylation K105 0.343 0.709 _RM(ox)LELVAQK(gl)QR_
UBXN1 Phosphorylation S200 -1.255 -2.127 _KYGGSVGSQPPPVAPEPGPVPSS(ph)PSQEPPTKR_
UBXN1 Ubiquitylation K83 -1.791 _EPTSSEQGGLEGSGSAAGEGK(gl)PALSEEER_
UBXN1 Ubiquitylation K96 -1.483 _EPTSSEQGGLEGSGSAAGEGKPALSEEERQEQTK(gl)R_
UBXN1 Ubiquitylation K178 -4.185 _K(gl)YGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR_

Background Information for UBXN1:


Pubmed-UBXN1 »
Uniprot-UBXN1 »
Biogrid-UBXN1 »
ProteomicsDB-UBXN1 »

Tumorportal-UBXN1 »
COSMIC-UBXN1 »
GenomeRNAi-UBXN1 »
Genecards-UBXN1


Protein-protein Interactions for UBXN1
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait A1BG Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait AARSD1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait CCDC102B Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait CDK5R1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait EMILIN1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait KLHL10 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait KLRG2 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait PSMC3 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait UBXN1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait YAF2 Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in UBXN1
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members Ubiquitin-rel_dom IPR029071 1.79
Category members UBA/Ts_N IPR000449 0.34
Category members UBA-like IPR009060 0.17
Category members UBX_dom IPR001012 0.08
Category members UBA/transl_elong_EF1B_N_euk IPR015940 0.04


Protein complexes (CORUM database) featuring UBXN1
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring UBXN1
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005515 protein binding Database INF
Category members GO Category GO:0005634 nucleus Database INF
Category members GO Category GO:0005737 cytoplasm Database 12.81
Category members GO Category GO:0000502 proteasome complex Database 3.17
Category members GO Category GO:0031625 ubiquitin protein ligase binding Database 2.54
Category members GO Category GO:0043130 ubiquitin binding Database 1.22
Category members GO Category GO:0031593 polyubiquitin binding Database 0.38
Category members GO Category GO:0030425 dendrite Database 0.26
Category members GO Category GO:0034098 Cdc48p-Npl4p-Ufd1p AAA ATPase complex Database 0.25
Category members GO Category GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Database 0.23
Category members GO Category GO:0031397 negative regulation of protein ubiquitination Database 0
Category members GO Category GO:0032435 negative regulation of proteasomal ubiquitin-dependent protein catabolic process Database 0
Category members GO Category GO:0043025 neuronal cell body Database 0
Category members GO Category GO:0051117 ATPase binding Database 0


.

© Copyright Svejstrup Laboratory 2015