bioLOGIC Data
Query: LPCAT4
| RNAi screen result | RNAPII IP (PI) | CSB IP | CSB IP (PI) | Chrom. | Chrom. (PI) | Phosphorylation | Ubiquitylation |
| W | |||||||
[Click on the plots to view the data selection in the respective scatterplot]
Protein Results:
Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen| Gene name | Point score | Z-score sums | RNAi high | RNAi low | RNAPII-IP (PI) | CSB-IP | CSB-IP (PI) | Chrom. | Chrom. (PI) |
|---|---|---|---|---|---|---|---|---|---|
| LPCAT4 | 0 | -1.886 | 0.590 | -0.440 |
PTM Sites:
Back to Protein Results | Red/green: hit at lower/upper end of the respective screen| Gene name | PTM type | PTM site | UV | UV (PI) | Sequence |
|---|---|---|---|---|---|
| LPCAT4 | Phosphorylation | S2 | -1.886 | _(ac)S(ph)QGSPGDWAPLDPTPGPPASPNPFVHELHLSR_ |