bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
REACTOME_ACYL_CHAIN_REMODELLING_OF_PE
(Pathway_494)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
LPCAT3 0 -1.220 1.200 0.300 0.355
PLA2G12A 0 1.990 -0.950
PNPLA8 0 0.270 -0.360 -0.075 0.032 -0.336 0.525 0.443
MBOAT2 0 -0.770 0.950
PLA2G4D 0 -0.560 0.650 -4.263
LPCAT4 0 0.590 -0.440

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
LPCAT3 Ubiquitylation K312 0.742 _AK(gl)WDACANMK_
LPCAT4 Phosphorylation S2 -1.886 _(ac)S(ph)QGSPGDWAPLDPTPGPPASPNPFVHELHLSR_
MBOAT2 Ubiquitylation K484 0.123 _NTHENIQLSQSK(gl)K_
MBOAT2 Ubiquitylation K485 0.123 _NTHENIQLSQSK(gl)K_
PLA2G12A Ubiquitylation K36 0.088 _ATLK(gl)TIR_


© Copyright Svejstrup Laboratory 2015