bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
phosphatidylglycerol acyl-chain remodeling
(GO:0036148)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
CRLS1 0 -0.260 0.430
LPGAT1 0 -0.960 0.920 -0.396 0.147
PLA2G12A 0 1.990 -0.950
LPCAT1 0 0.790 -0.740 0.844 0.107 0.289
PLA2G4D 0 -0.560 0.650 -4.263
LPCAT4 0 0.590 -0.440

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
CRLS1 Ubiquitylation K225 -0.176 _TLAK(gl)YFNPCYATAR_
LPCAT1 Ubiquitylation K191 -1.958 -0.654 _TVEEIK(gl)R_
LPCAT1 Ubiquitylation K221 -2.397 _TCLITFK(gl)PGAFIPGAPVQPVVLR_
LPCAT1 Ubiquitylation K347 -0.307 _GLGLKPEK(gl)_
LPCAT4 Phosphorylation S2 -1.886 _(ac)S(ph)QGSPGDWAPLDPTPGPPASPNPFVHELHLSR_
LPGAT1 Ubiquitylation K165 0.320 _SYRDQQLLLLKK(gl)_
PLA2G12A Ubiquitylation K36 0.088 _ATLK(gl)TIR_


© Copyright Svejstrup Laboratory 2015